DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG6254

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_649983.2 Gene:CG6254 / 41244 FlyBaseID:FBgn0037794 Length:634 Species:Drosophila melanogaster


Alignment Length:396 Identity:97/396 - (24%)
Similarity:169/396 - (42%) Gaps:87/396 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DERVVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEECGMELDLDSEG 173
            :::.:.||||..::|    .:|:.:...|...|.:     |:.|.:|:.:|:|...:|.::|:.|
  Fly   173 EKQCLQEKQDFPKEE----DVIEEEMQISGVEEEI-----LEEDVEEDLAEEEVETVEEEIDTVG 228

  Fly   174 RHSAKIPH--------SC-----PHCT--------KVYQSRKV----LERHIMRQH--------- 204
            .....:..        .|     .|.|        ::.:..:|    :|.:.:.||         
  Fly   229 EEVEAVEEELETQDATDCLVEEVEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPVET 293

  Fly   205 KDTLSPDVDSEDA------DYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEG 263
            |||:.....:||.      ::...::..:......|||..|.|.|....:.::|::..|:...: 
  Fly   294 KDTVESIESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHMEEVHNTVAD- 357

  Fly   264 GSAIFTCLECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYKTRHELKRHQLKHTSERNVP----- 323
                        .||:|.              |..|...:.|..:|..|...|.  |..|     
  Fly   358 ------------DLPQLE--------------CNQCKLCFPTVAQLHAHHRTHV--RAKPKTDNC 394

  Fly   324 CPHPGCGKRFFTIRHMRNHGK-VHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDK 387
            |||  |.|||.|...::.|.: :|.:.|.:||:.||.|......|:.|...||.|.||.|.||.:
  Fly   395 CPH--CEKRFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPFECPVCKR 457

  Fly   388 RFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLA 452
            .|.:::.|:.|:..||.| .:.|:|||.....::....||.:|:||:||.|::||:|:.::..|.
  Fly   458 GFKNNARLKIHLDTHSAE-IYECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRSKTLK 521

  Fly   453 GHMRKH 458
            .|:..|
  Fly   522 AHLILH 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 5/19 (26%)
zf-C2H2_8 323..411 CDD:292531 33/93 (35%)
C2H2 Zn finger 327..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 367..389 CDD:290200 10/21 (48%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 395..419 CDD:290200 9/23 (39%)
C2H2 Zn finger 410..430 CDD:275368 6/19 (32%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)
CG6254NP_649983.2 zf-AD 21..99 CDD:285071
COG5048 <353..554 CDD:227381 61/207 (29%)
C2H2 Zn finger 364..384 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..416 CDD:275368 9/22 (41%)
C2H2 Zn finger 424..444 CDD:275368 6/19 (32%)
C2H2 Zn finger 452..472 CDD:275368 6/19 (32%)
C2H2 Zn finger 479..499 CDD:275368 6/19 (32%)
C2H2 Zn finger 507..527 CDD:275368 6/19 (32%)
zf-H2C2_2 520..544 CDD:290200 3/8 (38%)
C2H2 Zn finger 535..553 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.