DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG17359

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:366 Identity:80/366 - (21%)
Similarity:133/366 - (36%) Gaps:88/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RVVLEKQD--EDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEECGMELDLDSEG 173
            ||..::.|  .|....|..|..:.|:.:.:.:..||:.....| :||:...|..|   ::.....
  Fly     8 RVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSV-HKEDGMPQFIC---VECAEAV 68

  Fly   174 RHSAKIPHSCPHCTKVYQSRKVLERHI-----MRQHKDTLSPD-------------------VDS 214
            |::.::...|....:.::..:::.:.:     .....|.:.|.                   |:.
  Fly    69 RNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLVEL 133

  Fly   215 EDADYEPPKDAPVKS---------AAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTC 270
            ....|.||:..|:.|         .||.|.   ..|..|.|...|.....|:|:...        
  Fly   134 VQVKYMPPEPKPISSPLPDNNEHKLAQSYS---PAKTPHNKSKRRARSYSDNDSWSP-------- 187

  Fly   271 LECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPG------C 329
               :::|                            .|| ...::.:.|:|..|...||      |
  Fly   188 ---DSEL----------------------------EHE-DDDKIWNASKRGKPKRVPGPYRCKLC 220

  Fly   330 GKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSG 394
            .:.|...:::..|.::||.::.:.|..|..|...|..|:.|.|.|||||||||..|.|||.....
  Fly   221 TQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQ 285

  Fly   395 LREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQ 435
            |:.|...|:.|:|..||.|..:|.:..||..|...|...|:
  Fly   286 LQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 2/19 (11%)
zf-C2H2_8 323..411 CDD:292531 33/93 (35%)
C2H2 Zn finger 327..346 CDD:275368 5/24 (21%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 367..389 CDD:290200 14/21 (67%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-H2C2_2 395..419 CDD:290200 9/23 (39%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 438..458 CDD:275368
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 16/83 (19%)
zf-C2H2 215..237 CDD:278523 3/21 (14%)
C2H2 Zn finger 217..237 CDD:275368 3/19 (16%)
zf-H2C2_2 229..254 CDD:290200 6/24 (25%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 16/24 (67%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 9/23 (39%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.