DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG10654

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:415 Identity:93/415 - (22%)
Similarity:152/415 - (36%) Gaps:133/415 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKSLKPDTYAGMANAKCGEIYFQSLHSFRIDCAFCEMKSFVFGDFLLHVQNIHFENGLLKTE-- 63
            :|||:          .:|.....|..|.|:..||. .:::|   :.||  |:|  :.|..|.|  
  Fly    83 VLKSI----------CECCYQLVQKFHDFQRMCAE-SLRNF---EKLL--QDI--DIGCHKLEDH 129

  Fly    64 ---ATDAGANLKQERDREREPNSP-VPIVAQVNPFAWYEI-------------GGDHNEDSDDER 111
               ..|..:...:..:.|.:.::| :....::..|.|.::             |.    ..::|.
  Fly   130 TWHDLDTPSESNESTNPEAQSHAPCIAATQEIVSFIWPQVCLPLAVILSRITLGA----SLEEEV 190

  Fly   112 VVLEKQDEDEDERPGRSIIKWQDHQSLTSESL--RQVRALKVDYKEEDSEQEECG---------- 164
            .|:|.:...:|        ..|:..|::|:.|  |:.|.::        ...||.          
  Fly   191 YVIEDESAKQD--------LGQEKLSISSKLLGARKRRGVR--------HTLECRICHRGFYKPS 239

  Fly   165 -MELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVK 228
             :|..:.   :|....|::|.||.|.|....:||.|:.:.|          .:||          
  Fly   240 LLEAHMQ---QHEGLRPYTCVHCAKSYARANLLESHLRQMH----------NNAD---------- 281

  Fly   229 SAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGG 293
            :|...|.|..|.|:|....||:.|::|.|:...|..|            |..|    |:      
  Fly   282 AARIIYACPSCNKVYTANRSLKYHMRRTHERYHESES------------PDAR----HI------ 324

  Fly   294 AACVVCGRRYKTRHELKRHQLKHTS--ERNVPCPHPGCGKRFFTIRHM-----RNHGKVHTEQKN 351
              |..||:.:..:..|.||::.|.|  .|...|  ..|.:||:|..:|     |.||     .||
  Fly   325 --CEECGKCFARKAHLTRHKMVHGSVEGRRYCC--ECCDRRFYTKENMVDHLLRKHG-----NKN 380

  Fly   352 FV--CESCGYSCRNKETLRVHIRSH 374
            .:  |..||...:|...|..|.|.|
  Fly   381 LLLRCRKCGRIFQNSVELNAHGRKH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 6/19 (32%)
zf-C2H2_8 323..411 CDD:292531 19/59 (32%)
C2H2 Zn finger 327..346 CDD:275368 8/23 (35%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 367..389 CDD:290200 4/8 (50%)
C2H2 Zn finger 382..402 CDD:275368
zf-H2C2_2 395..419 CDD:290200
C2H2 Zn finger 410..430 CDD:275368
C2H2 Zn finger 438..458 CDD:275368
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 10/45 (22%)
C2H2 Zn finger 228..248 CDD:275368 2/22 (9%)
C2H2 Zn finger 256..313 CDD:275368 22/76 (29%)
C2H2 Zn finger 289..314 CDD:275368 9/24 (38%)
zf-C2H2 323..345 CDD:278523 7/29 (24%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 355..376 CDD:275368 7/22 (32%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.