DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and ZNF324B

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_997278.2 Gene:ZNF324B / 388569 HGNCID:33107 Length:544 Species:Homo sapiens


Alignment Length:464 Identity:118/464 - (25%)
Similarity:172/464 - (37%) Gaps:142/464 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VQNIHFENGLLKTEATDAGANL---------KQERDRE----------REPNSPVPIVAQVNPFA 95
            |..|::|..||.:.:..|..:|         |..|.||          |:|.:|    .:..|.|
Human   139 VSVIYWERLLLGSRSDQASISLRLTSPLRPPKSSRPREKTFTEYRVPGRQPRTP----ERQKPCA 199

  Fly    96 WYEIGGDHNEDSDDERVVLEKQDEDEDERPGRSIIKWQD-HQSLTSESLRQVRALKVDYKEEDSE 159
             .|:.|....::.|    |:......|.|.|.:   ||: |:.|..              :|.|.
Human   200 -QEVPGRAFGNASD----LKAASGGRDRRMGAA---WQEPHRLLGG--------------QEPST 242

  Fly   160 QEECGMELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKD 224
            .:|.|       |..|:.:....|..|:||:.....|.:| :|.|                    
Human   243 WDELG-------EALHAGEKSFECRACSKVFVKSSDLLKH-LRTH-------------------- 279

  Fly   225 APVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQ 289
                :..:.|:|..|||.:.....|.||.:                                   
Human   280 ----TGERPYECTQCGKAFSQTSHLTQHQR----------------------------------- 305

  Fly   290 AHGGA---ACVVCGRRYKTRHELKRHQLKHTSERNVPCP------------------HPG----- 328
            .|.|.   ||.|||:.::....|.|||..||:|::..|.                  |.|     
Human   306 IHSGETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCSECGKAFSHGSNLSQHRKIHAGGRPYA 370

  Fly   329 ---CGKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFP 390
               ||:||....|:..|.:.||.:|.|||..||.:.....:|.:|.|.||||:||.|..|.:.|.
Human   371 CAQCGRRFCRNSHLIQHERTHTGEKPFVCALCGAAFSQGSSLFLHQRVHTGEKPFACAQCGRSFS 435

  Fly   391 SHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHM 455
            ..|.|.:|..:|:.|||..|..||..|::...|..|:.:|...|.|||..||.|:.:...|..|.
Human   436 RSSNLTQHQLLHTGERPFRCVDCGKGFAKGAVLLSHRRIHTGEKPFVCTQCGRAFRERPALLHHQ 500

  Fly   456 RKHRNDELN 464
            |.|..::.|
Human   501 RIHTTEKTN 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 8/19 (42%)
zf-C2H2_8 323..411 CDD:292531 36/113 (32%)
C2H2 Zn finger 327..346 CDD:275368 7/26 (27%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 367..389 CDD:290200 11/21 (52%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 395..419 CDD:290200 10/23 (43%)
C2H2 Zn finger 410..430 CDD:275368 6/19 (32%)
C2H2 Zn finger 438..458 CDD:275368 7/19 (37%)
ZNF324BNP_997278.2 KRAB 1..61 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..222 9/46 (20%)
C2H2 Zn finger 259..279 CDD:275368 7/20 (35%)
COG5048 <268..499 CDD:227381 77/290 (27%)
C2H2 Zn finger 287..307 CDD:275368 7/54 (13%)
C2H2 Zn finger 315..335 CDD:275368 8/19 (42%)
C2H2 Zn finger 343..363 CDD:275368 1/19 (5%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 399..419 CDD:275368 6/19 (32%)
C2H2 Zn finger 427..447 CDD:275368 6/19 (32%)
C2H2 Zn finger 455..475 CDD:275368 6/19 (32%)
C2H2 Zn finger 483..503 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..544 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.