DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CTCF

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster


Alignment Length:457 Identity:107/457 - (23%)
Similarity:163/457 - (35%) Gaps:98/457 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ATDAGANLKQE---------------RDREREPNSPVPIVAQVNPFAWYEIGGDHNEDSDDERVV 113
            |..|.|..||.               |.|.|:.    |::.:..|........:..::.|...:|
  Fly   160 ARAAAAKAKQSAMPPPPALVVKVPAPRGRPRKN----PVIPKPEPMDLERELEELVDEPDISSMV 220

  Fly   114 LEKQDEDEDE----------RPGRS-IIKWQDHQSLTSESLRQVRALKVDYKEED---SEQEECG 164
            .|..|...||          .|..: :.:::|:.:...|:        .|.|:.|   |.:|...
  Fly   221 TELSDYTVDEAAVEAATATLTPNEAEVYEFEDNATTEDEN--------ADKKDVDFVLSNKEVKL 277

  Fly   165 MELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKS 229
            ......|:..:::...:|||||......:.::.|| .|.|             |.||        
  Fly   278 KTASSTSQNSNASGHKYSCPHCPYTASKKFLITRH-SRSH-------------DVEP-------- 320

  Fly   230 AAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEG----GSAIFT-------------------CL 271
               .:||..|.:.:.....|:.|:.....|....    .||..|                   |.
  Fly   321 ---SFKCSICERSFRSNVGLQNHINTHMGNKPHKCKLCESAFTTSGELVRHTRYKHTKEKPHKCT 382

  Fly   272 ECEAQLPRLRLLDEHMVQAHGGA---ACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRF 333
            ||......|..|..||. .|.|.   .|..|....:...:||||.:.||.|:...|..  |..||
  Fly   383 ECTYASVELTKLRRHMT-CHTGERPYQCPHCTYASQDMFKLKRHMVIHTGEKKYQCDI--CKSRF 444

  Fly   334 FTIRHMRNHGKVHT--EQKNFVCESCGYSCRNKETLRVHIR-SHTGERPFGCQVCDKRFPSHSGL 395
            .....::.|..:|:  ::..|.|..|..:|..|..|||||: .||.:.|..|:.|.::.|.....
  Fly   445 TQSNSLKAHKLIHSVVDKPVFQCNYCPTTCGRKADLRVHIKHMHTSDVPMTCRRCGQQLPDRYQY 509

  Fly   396 REHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKHRN 460
            :.|:..|..|:.:.|.:|......|:.|..|..:|.|.|.|.|..|..|:.|...|..||....|
  Fly   510 KLHVKSHEGEKCYSCKLCSYASVTQRHLASHMLIHLDEKPFHCDQCPQAFRQRQLLRRHMNLVHN 574

  Fly   461 DE 462
            :|
  Fly   575 EE 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 6/19 (32%)
zf-C2H2_8 323..411 CDD:292531 25/90 (28%)
C2H2 Zn finger 327..346 CDD:275368 4/18 (22%)
C2H2 Zn finger 354..374 CDD:275368 9/20 (45%)
zf-H2C2_2 367..389 CDD:290200 10/22 (45%)
C2H2 Zn finger 382..402 CDD:275368 4/19 (21%)
zf-H2C2_2 395..419 CDD:290200 5/23 (22%)
C2H2 Zn finger 410..430 CDD:275368 5/19 (26%)
C2H2 Zn finger 438..458 CDD:275368 7/19 (37%)
CTCFNP_648109.1 23ISL <116..206 CDD:293226 10/49 (20%)
C2H2 Zn finger 296..316 CDD:275368 7/20 (35%)
COG5048 321..>621 CDD:227381 70/259 (27%)
zf-C2H2 322..344 CDD:278523 5/21 (24%)
C2H2 Zn finger 324..344 CDD:275368 4/19 (21%)
zf-H2C2_2 337..361 CDD:290200 5/23 (22%)
C2H2 Zn finger 352..373 CDD:275368 3/20 (15%)
C2H2 Zn finger 381..401 CDD:275368 7/20 (35%)
zf-H2C2_2 394..415 CDD:290200 7/21 (33%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
zf-H2C2_2 422..446 CDD:290200 11/25 (44%)
C2H2 Zn finger 437..457 CDD:275368 5/21 (24%)
C2H2 Zn finger 467..485 CDD:275368 8/17 (47%)
C2H2 Zn finger 496..516 CDD:275370 4/19 (21%)
C2H2 Zn finger 524..544 CDD:275368 5/19 (26%)
zf-H2C2_2 536..561 CDD:290200 9/24 (38%)
C2H2 Zn finger 552..573 CDD:275368 7/20 (35%)
zf-C2H2 587..609 CDD:278523
C2H2 Zn finger 589..609 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.