DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG2199

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster


Alignment Length:397 Identity:77/397 - (19%)
Similarity:142/397 - (35%) Gaps:83/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SFVFGDFLLHVQNIHFENGLLKTEATDAGANLKQERDREREPN-------SPVPIVAQVNPFAWY 97
            |||.|      .|.:.|..::...........|::..|..|.|       :|...|:.... |:.
  Fly   136 SFVNG------ANTNTEIEIISASPKKLDKTPKKQISRLFEDNLNDSVKLTPAKEVSSTKK-AFL 193

  Fly    98 EIGGDHNEDSDDERVVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEE 162
            .:.|:...|:.:   ||.:.:|:||...|...|...:.|....|...:   ....|||.      
  Fly   194 NLFGNGGNDAIE---VLTESEEEEDSDKGPITINTNNFQCPECEFHAK---FPKPYKEH------ 246

  Fly   163 CGMELDLDSEGRHSAKIP--HSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDA 225
                  |..|  |..:.|  :.|..|.|.:...|.|:.|:...|..|...:..::..:   .|:.
  Fly   247 ------LQKE--HGLQRPRIYPCTLCIKTFGVLKTLKNHLRDTHSRTFESEAKTKAKE---SKEK 300

  Fly   226 PVKSAAQ---EYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHM 287
            ..||.|:   :.|.:....:     |.|:..|......::      |.::|..:...:..:|:.:
  Fly   301 EAKSGAKNKIDAKAKETNAV-----SQRKKPKEKKSKEKK------TEIKCNVETKVVDEIDDQV 354

  Fly   288 VQAHG--------GAACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGK 344
            ....|        ..|..:...:......:|:..|::..:          .:..|.|    |...
  Fly   355 NNKKGTDSEDADQTQATKIASFKALNESLMKKRMLENVID----------SEYTFAI----NGSS 405

  Fly   345 VHT---EQKNFVCESCGYSCRNKETLRVHIRS-HTGERP--FGCQVCDKRFPSHSGLREHMAMHS 403
            ..|   :..||.||.|.......:.::.|::: |:.::|  |.|.||:|...:...|:.||.:|:
  Fly   406 ASTPRADSNNFQCEICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLHA 470

  Fly   404 --TERPH 408
              .|.|:
  Fly   471 DGAEAPN 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 2/19 (11%)
zf-C2H2_8 323..411 CDD:292531 23/94 (24%)
C2H2 Zn finger 327..346 CDD:275368 3/18 (17%)
C2H2 Zn finger 354..374 CDD:275368 4/20 (20%)
zf-H2C2_2 367..389 CDD:290200 8/24 (33%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-H2C2_2 395..419 CDD:290200 6/16 (38%)
C2H2 Zn finger 410..430 CDD:275368
C2H2 Zn finger 438..458 CDD:275368
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 4/20 (20%)
C2H2 Zn finger 449..469 CDD:275370 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.