DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG8089

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:541 Identity:111/541 - (20%)
Similarity:182/541 - (33%) Gaps:183/541 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKSLKPDTYAGMANAKCGEIYFQSL-----------HSFRIDCAFCEMKSFVFGDFLLHV----- 50
            |..|:.|.|      ||..:.::.|           :|....|..|..:.::......|:     
  Fly   164 LPGLRCDCY------KCENLPWKKLQDVEDHQKTHRYSDNFHCQICYRRFYLQHSLTSHIIRKST 222

  Fly    51 --QNIHFEN----GLLKTEATDAGANLKQERDREREPNSPVPIVAQVNPFAWYEIGGDHNEDSDD 109
              :.:| ||    .||:.:.:      ::|::.|...|....|:..|               ::|
  Fly   223 SSRELH-ENKRYKRLLENQKS------QEEKELELSLNKVEDILVPV---------------AED 265

  Fly   110 ERVVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEECGMELDLDSEGR 174
                |:...:||.:.|         .|...:.||.:..:...:|....|.|    :.:......|
  Fly   266 ----LQSYFKDESKHP---------IQKRKTSSLSKCPSCAQNYGFSFSHQ----LHMVKHRRER 313

  Fly   175 HSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYKCEHC 239
            .....|..|..|.:.:.:||.|.:|  :|...|.|..:      |.|            :||.||
  Fly   314 LYTNFPFHCSFCNRSFLTRKFLRKH--QQRVRTFSTLL------YRP------------FKCPHC 358

  Fly   240 GKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYK 304
            ...:..|.:|..|:.|.|:..:       .||.|  :||..||    ...||....|....::|:
  Fly   359 TWRFQLKSALDSHVLRIHERRK-------PCLIC--KLPTSRL----CCSAHTSKECNRAMQKYR 410

  Fly   305 TRHELKRHQLKHTSERNVPCPHPGC-------GKRFFTIRHMRNHGKVHTEQKNFVCESCG---Y 359
            .:....|...|....:.   |.|.|       .::||...||   .|.|..::||.||.||   |
  Fly   411 DKMRPLREPPKGGCRKQ---PTPVCKICNRKFTRKFFLEEHM---NKAHLNKRNFTCEICGANFY 469

  Fly   360 SCRNKETLR--VHIRSHTGERPFGCQVCDKRFPSHSGLREH------------------------ 398
            |....:|.|  ||:..||.:    |:|||....|....|.|                        
  Fly   470 SQGTMQTHRKAVHLLVHTVQ----CEVCDLTIKSKGNYRRHCKSQSHKDNLVKFGKNNDKTKDSN 530

  Fly   399 -----------MAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQF---------------V 437
                       :.:.::...:.|..     |..|..:::|.:...|||.               :
  Fly   531 RRKGARTTDEKLDIEASSSTNTCMT-----SANKSTHNYKKMGIKTKQTHLKTPCRSKKRVKIKI 590

  Fly   438 CKLCGNAYAQAAGLAGHMRKH 458
            |:.|||:      :.|.|::|
  Fly   591 CETCGNS------IVGSMQRH 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 3/19 (16%)
zf-C2H2_8 323..411 CDD:292531 30/134 (22%)
C2H2 Zn finger 327..346 CDD:275368 7/25 (28%)
C2H2 Zn finger 354..374 CDD:275368 10/24 (42%)
zf-H2C2_2 367..389 CDD:290200 9/23 (39%)
C2H2 Zn finger 382..402 CDD:275368 7/54 (13%)
zf-H2C2_2 395..419 CDD:290200 3/58 (5%)
C2H2 Zn finger 410..430 CDD:275368 4/19 (21%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 3/23 (13%)
C2H2 Zn finger 322..343 CDD:275368 7/22 (32%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 432..453 CDD:275368 6/23 (26%)
C2H2 Zn finger 461..486 CDD:275368 10/24 (42%)
C2H2 Zn finger 490..506 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.