DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG12942

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_610628.2 Gene:CG12942 / 36158 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster


Alignment Length:370 Identity:80/370 - (21%)
Similarity:135/370 - (36%) Gaps:99/370 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 DDERVVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQE-ECGMELDLDS 171
            :|:.:.|.|...          .|.:...|..::...:::...:|:.:.|.:.| .|.|:.    
  Fly   333 EDDIIGLNKNQN----------FKCRPCNSYETKDRSEMQKHLIDHHKIDGDFEMYCYMQA---- 383

  Fly   172 EGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVK---SAAQE 233
                      :||.|.::::.::...:|..|.|                    .||:   |..:.
  Fly   384 ----------NCPACDRIFKDQRSARKHYTRVH--------------------TPVQIAVSPTES 418

  Fly   234 YKCEHCGKIYHGKYSLRQHLK----RDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGA 294
            |.|..|.|:::.|.||..|.:    :|          :..|..|:.|...:|..:.|:.|.|...
  Fly   419 YACTACDKVFNQKASLHSHQRFCQVKD----------VVHCSFCDQQFNSMRKYELHLQQLHAVE 473

  Fly   295 A---CVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCES 356
            .   |.:|.|.:|:...|..|:.:| |||     |..|||                         
  Fly   474 TVHECEICRRSFKSAETLTMHRKRH-SER-----HYQCGK------------------------- 507

  Fly   357 CGYSCRNKETLRVHI-RSHTGERPFGCQVCDKRFPSHSGLREH-MAMHSTERPHVCSVCGATFSR 419
            |..:..|...||||. |:|..|.|..|..|..:|.:.:.|||| ...|...:...|.||......
  Fly   508 CSLNYVNSAELRVHYERAHVNEEPVSCLTCGNQFQNMTLLREHEQRSHQKSKVWRCEVCNFETKT 572

  Fly   420 QKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKHRNDELN 464
            :.....|::.|.| ..:.|:.|.:.:|..:....|.:|....||:
  Fly   573 RWRRRQHQYEHMD-YPYKCQKCTSEFADRSKFRQHSKKVHGIELS 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 6/19 (32%)
zf-C2H2_8 323..411 CDD:292531 22/89 (25%)
C2H2 Zn finger 327..346 CDD:275368 3/18 (17%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 367..389 CDD:290200 10/22 (45%)
C2H2 Zn finger 382..402 CDD:275368 7/20 (35%)
zf-H2C2_2 395..419 CDD:290200 8/24 (33%)
C2H2 Zn finger 410..430 CDD:275368 4/19 (21%)
C2H2 Zn finger 438..458 CDD:275368 4/19 (21%)
CG12942NP_610628.2 zf-AD 22..101 CDD:285071
C2H2 Zn finger 385..406 CDD:275368 5/20 (25%)
C2H2 Zn finger 421..470 CDD:275368 14/58 (24%)
C2H2 Zn finger 449..466 CDD:275371 4/16 (25%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 505..526 CDD:275368 10/45 (22%)
C2H2 Zn finger 534..555 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.