DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG30020

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:659 Identity:118/659 - (17%)
Similarity:184/659 - (27%) Gaps:282/659 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DFLLHVQNIH--------FENGLLKTEATDAGANLKQERDREREPNSPVPIVAQVNPFAWYEIGG 101
            |.::...||.        ||:  .:.|..|..|:.:.|.|.|.|                    .
  Fly   652 DIVIDNNNISLDFDAENLFED--FEEEEDDTVADEEDEADNEDE--------------------N 694

  Fly   102 DHNEDSDDERVVLEKQDEDED----------ERP------------------------------- 125
            |:|:.:.|:.::|...|:|.|          ::|                               
  Fly   695 DNNDAATDQNLLLTSDDDDVDDFDDEQSKHLQKPYCIYCNKKFTSQYKFENHMFVHRGLAPYRCE 759

  Fly   126 --------GRSIIKWQD--HQSLTSESLRQVRALKVDYKEEDSEQ-------------EECGMEL 167
                    .|.:||...  |:.:.:..:.|.:..||.....:.|:             .:|..|.
  Fly   760 LCTNLYNMKRLLIKHYKTVHKRMPTRDMVQAKGDKVSVARTNIEKLYPGRIKNPMLMCAKCPFEC 824

  Fly   168 DLDSEGR---------------HS------AKIPHSCPHCTKVYQSRKVLERHIMR--------- 202
            :.|||.|               |:      .|:|..||.|.:.:.::..|.||:.|         
  Fly   825 ESDSEMRKHLNAHHGINDGVSEHANEVFIIRKLPFECPRCIRSFAAKTTLSRHLQRSHLVDTIIE 889

  Fly   203 --------------------------------QHKDTLSPDVDSE-------------------- 215
                                            ||.:.:..||.:|                    
  Fly   890 MQTPHCGEAITTTMATSSSTISEPVNSVTVDGQHNEMMQTDVGAEKMTEALGNGDGNEEGGTDDG 954

  Fly   216 ----------------------------------------------------------------- 215
                                                                             
  Fly   955 TGVKAEPAVPEEELDPVTLDAATAVTTTAIAAAISAAAAATATSLESPVATTASSSTTLFPTPTP 1019

  Fly   216 -DADYEPPKD-----AP----VKSAAQEYKCEHCGKIYHGKYSL-------RQHLKRDHDNGEEG 263
             |.||:..:|     :|    |..|..:.....|.  .:..|.|       ....|....|....
  Fly  1020 FDFDYDIMRDEAQQSSPNIHDVSKALSDNASSSCP--INESYKLLSTTALETSPAKGLRSNSRLH 1082

  Fly   264 GSAIFTCLECEAQLPRLRLLDEHMVQAHGGA---------ACVVCGRRYKTRHELKRHQLKHTSE 319
            .|:|..|..|......|..|.:|.::.|...         .|.:|...|:|...||.|..:| |.
  Fly  1083 RSSIHICKLCNQTFDELGKLVKHEMELHSNTERSRWGYQHKCAICNTSYRTLTLLKFHMKRH-SN 1146

  Fly   320 RNVPCPHPGCGKRFFTIRHMRNHGKV-HTEQKNFVCESCGYSCRNKETLRVHI-----RSHTGER 378
            |...|..  |.|.|.||..:..|.|. |::.|...|...|  ||.....:.|:     .||...|
  Fly  1147 RKSQCKL--CPKSFVTIAELERHTKAKHSKDKTLRCFMDG--CRKTFAFKHHLIRHQKASHLSTR 1207

  Fly   379 PFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGN 443
             :.|.||:|...|:..|:.||::|..|..:.|..|..::.|:..|..|..:..|.: |..:..||
  Fly  1208 -YICPVCNKEEKSNVHLKNHMSVHKGEITYKCPKCDRSYLRRGRLVTHALIIHDLR-FTTEELGN 1270

  Fly   444 AYAQAAGLA 452
            ..:.|...|
  Fly  1271 LSSLATNQA 1279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 7/19 (37%)
zf-C2H2_8 323..411 CDD:292531 28/93 (30%)
C2H2 Zn finger 327..346 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..374 CDD:275368 5/24 (21%)
zf-H2C2_2 367..389 CDD:290200 8/26 (31%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
zf-H2C2_2 395..419 CDD:290200 7/23 (30%)
C2H2 Zn finger 410..430 CDD:275368 5/19 (26%)
C2H2 Zn finger 438..458 CDD:275368 4/15 (27%)
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368 0/19 (0%)
C2H2 Zn finger 758..777 CDD:275368 3/18 (17%)
C2H2 Zn finger 1089..1110 CDD:275368 5/20 (25%)
C2H2 Zn finger 1124..1144 CDD:275368 7/19 (37%)
C2H2 Zn finger 1151..1172 CDD:275368 8/22 (36%)
C2H2 Zn finger 1180..1203 CDD:275368 5/24 (21%)
C2H2 Zn finger 1210..1230 CDD:275368 8/19 (42%)
C2H2 Zn finger 1238..1254 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.