DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG1602

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster


Alignment Length:590 Identity:117/590 - (19%)
Similarity:213/590 - (36%) Gaps:180/590 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CGEI-YFQSLHSFRIDCAFC--EMKSFVFGDFLLHVQNIHFENGLLKTEATDAGANLKQE---RD 76
            ||.| ..:....|.:.|::|  :::...:.:|:||::|:|.:...::.:....|.|..:.   ..
  Fly     4 CGLICVSRDYEKFLMRCSYCPTDVEVAQWQEFVLHIRNVHSKVRSMEDDFEPVGENSTESGHVDP 68

  Fly    77 REREPNSPVPIVAQVNPF--AWYEIGGD------HNEDSDDERVVLEKQDEDEDERPGRSII--- 130
            .|.:|.:...|..|....  |..::..|      :..:..|..:|.::::..:||.|....:   
  Fly    69 PEEKPQAEESIFQQDESADGACVQLHIDAVRSSTNETEESDVSLVTDEEESVQDEDPSEPALDDA 133

  Fly   131 ------KWQDHQSLTSESLRQVRALKV-------------DYKEE-------------------- 156
                  .::.|.|......|.::.:::             ||||.                    
  Fly   134 NLKTTPTYKFHPSFFRRDHRTIKFIEIYKEHPCLWNPAHSDYKEPKKCKEALKRMAIDLEATVSV 198

  Fly   157 ----------------------------------------------DSEQEECG------MELDL 169
                                                          ::..:|.|      ::||.
  Fly   199 FLNEMALKLAIKKVHMQFNTVHKRVVSGKQKPQSLAFSIYKLCCFLNASNDEEGATNNEKIKLDF 263

  Fly   170 DSEGRHSAKIPHSCPHCTKVYQS--RKVLERHIMRQHKDTLS-----PDVDSEDAD--------- 218
            ..:.:.:..:.....:..::|.|  ::.......:|..::::     |:||....|         
  Fly   264 SKKNKLTTDLIEMYANFPQLYDSNHKEFSNMSSRKQAYESMAAEISVPNVDINSDDIFRAIQNLR 328

  Fly   219 ---YEPPKDA------------------PVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEE 262
               |:..|.|                  |.|...|...||.|.:|....:.|:.|:.:.|:.|| 
  Fly   329 QWYYKNTKHAIYAGSTAEKFYLEVCRFMPAKMYKQRLVCEFCHQITSSDHVLQSHIFKAHNIGE- 392

  Fly   263 GGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYKTRHELKRH-QLKHTSERNVPCPH 326
                          ||               ..|.:|.|.:..|.||..| |..|..:.: .|.|
  Fly   393 --------------LP---------------FKCTLCDRSFVGRCELANHIQRVHIGKTH-KCTH 427

  Fly   327 PGCGKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRS-HTGERPFGCQVCDKRFP 390
              |.:.|..:..::.|.:.||..|.:|||.||.:.|.:..:.:|:.: ||..|.|.|.:|.|.|.
  Fly   428 --CERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPKDFV 490

  Fly   391 SHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHM 455
            ....|.:|:..|...|..:|||||..|:....|..|:.:|::.|:||||||.:.::|..||..||
  Fly   491 KKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRHRQIHSEVKKFVCKLCDSRFSQFVGLNTHM 555

  Fly   456 RKHRN 460
            ::..|
  Fly   556 KRTHN 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 8/20 (40%)
zf-C2H2_8 323..411 CDD:292531 27/88 (31%)
C2H2 Zn finger 327..346 CDD:275368 3/18 (17%)
C2H2 Zn finger 354..374 CDD:275368 6/20 (30%)
zf-H2C2_2 367..389 CDD:290200 8/22 (36%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 395..419 CDD:290200 10/23 (43%)
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
C2H2 Zn finger 438..458 CDD:275368 9/19 (47%)
CG1602NP_610291.2 GT1 157..244 CDD:304916 4/86 (5%)
MADF_DNA_bdg 273..356 CDD:287510 10/82 (12%)
C2H2 Zn finger 367..388 CDD:275368 6/20 (30%)
C2H2 Zn finger 397..418 CDD:275368 8/20 (40%)
COG5048 <423..554 CDD:227381 46/133 (35%)
C2H2 Zn finger 425..445 CDD:275368 5/21 (24%)
zf-H2C2_2 437..460 CDD:290200 9/22 (41%)
C2H2 Zn finger 453..470 CDD:275368 5/16 (31%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 8/19 (42%)
C2H2 Zn finger 538..559 CDD:275368 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.