DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and az2

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:425 Identity:101/425 - (23%)
Similarity:164/425 - (38%) Gaps:70/425 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NIHFENGLLKTEATDAGANLKQ-ERDREREPNSPVPIVAQVNPFAWYEIGGDHNEDSD-DERVVL 114
            |:|.....||...|...|.... .|.::.:..:.||:        :|     |.:.|. .||..|
  Fly   197 NLHLTAYKLKKCITSLHAQYASISRQKKTQKLTKVPL--------YY-----HGKYSFLAERGSL 248

  Fly   115 EKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEECGMEL---------DLD 170
            |..|.|:.:..|:..:.:.:...||::.:.........|  :.:.:..|.:.:         ||.
  Fly   249 EDADSDDVDGDGKIKLVFTEENQLTTQFIDLYSKFPQLY--DPAHKHFCNLNVRKSSLIEITDLL 311

  Fly   171 SEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHK---DTLSPDVDSEDADYEPPKDA--PVKSA 230
            :.......:.|     ..||.|.:.:.:...|:.|   |.....:...:..|....::  |.||.
  Fly   312 TSEFSLGLVTH-----YDVYDSIQSMRQWYSRRIKTLTDVQCVGLSLAEKQYIERCNSFMPTKSF 371

  Fly   231 AQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAH--GG 293
            .|:.|||.|...:...::|:.|..|||..|:.|.   |.|..||....|...|.:|..:.|  ..
  Fly   372 RQKLKCEVCEHSFSTDHALQAHQFRDHKMGDGGW---FRCTLCELNFDRKCHLQQHSQRVHMDKS 433

  Fly   294 AACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCG 358
            ..|.:|.|.:...::|..|:                          |.|.:.|. .|.||||.||
  Fly   434 FVCEICSRSFAFGNQLAIHK--------------------------RTHDEKHV-AKPFVCEFCG 471

  Fly   359 YSCRNKETLRVHIRS-HTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKG 422
            ...:.|..:..|:.: ||..|.|.|.:|.|.|.:...|::|:..|...|..||.||...|:....
  Fly   472 KCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANA 536

  Fly   423 LYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRK 457
            |..|:.:|.: |...|.||...:::...|..|||:
  Fly   537 LVKHRHIHKE-KTLQCSLCTTRFSERVSLGVHMRR 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 5/19 (26%)
zf-C2H2_8 323..411 CDD:292531 25/88 (28%)
C2H2 Zn finger 327..346 CDD:275368 2/18 (11%)
C2H2 Zn finger 354..374 CDD:275368 6/20 (30%)
zf-H2C2_2 367..389 CDD:290200 8/22 (36%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 395..419 CDD:290200 9/23 (39%)
C2H2 Zn finger 410..430 CDD:275368 6/19 (32%)
C2H2 Zn finger 438..458 CDD:275368 7/20 (35%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 12/57 (21%)
GT1 276..>341 CDD:304916 9/71 (13%)
C2H2 Zn finger 377..398 CDD:275368 6/20 (30%)
C2H2 Zn finger 408..429 CDD:275368 6/20 (30%)
C2H2 Zn finger 436..456 CDD:275368 6/45 (13%)
C2H2 Zn finger 467..488 CDD:275368 6/20 (30%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368 6/19 (32%)
C2H2 Zn finger 551..572 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.