DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG17568

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:494 Identity:122/494 - (24%)
Similarity:179/494 - (36%) Gaps:123/494 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MANAKCGEIYFQSLHSFRIDCAFCEMKSFVFGDFLLHVQNIHFENGLLKTEATDAG-----ANLK 72
            :::..|.|.|  :|.|..||          |.:.:..||:| ||  :|:...||..     |.|:
  Fly    57 LSSVLCTECY--TLISELID----------FAEHVTKVQDI-FE--VLRRTETDGDQEMDVAALR 106

  Fly    73 QE----RDREREPNSPVPIVAQ------------VNPFAWYEIGGDHNEDSDDERV--VLEKQDE 119
            |:    .|.......|:|.:..            :..|...|......|.|.....  :::.:..
  Fly   107 QQFGLCDDDWTHIIKPIPALEMESDNVYQKPAELLKDFPLAETSSQEMEISKRTTTTHLIQTKKN 171

  Fly   120 DEDERP-------GRSIIKWQDHQ--------SLTSESLRQVRALKVDYKEEDSEQEECGMELDL 169
            .|.|.|       |..:::....|        .|..|.|.|.|.        ||......||.|:
  Fly   172 VEMEIPKQEFIDLGPILLEKNTSQLDMEDVLDELPQEELSQPRL--------DSTTSPASMENDV 228

  Fly   170 DSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAP--VKSAAQ 232
            .||      :..||                   :..|...| ||.:..|.......|  ::|.|:
  Fly   229 KSE------MLDSC-------------------EGDDDFLP-VDGQLMDLVAVATTPNTLESTAE 267

  Fly   233 E------YKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAH 291
            |      ..||.|||:|..:.|..:||:|                ||       |.::..:....
  Fly   268 EKAKRGRMDCEKCGKVYRNRASYEKHLER----------------EC-------RRIERRVKVDK 309

  Fly   292 GGAACVVCGRRYKTRHELKRHQLKHTSERNV-PCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCE 355
            ....|.:|.:...:...||.|  |....:|| |.....|||:..||..:..|..||||.:.|.|.
  Fly   310 TTTTCDICNKTLSSATALKLH--KEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECT 372

  Fly   356 SCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQ 420
            .|....:|:..|:.|.:.| .|..|.|.:|.|:..:......|..:|:.||...|.||||.|.|.
  Fly   373 VCKAGFKNRARLKAHYQIH-AEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRS 436

  Fly   421 KGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGH-MRKH 458
            |.|..|...|...:.:||..||.::|..|....| ::||
  Fly   437 KTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSHKLKKH 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 5/19 (26%)
zf-C2H2_8 323..411 CDD:292531 27/87 (31%)
C2H2 Zn finger 327..346 CDD:275368 6/18 (33%)
C2H2 Zn finger 354..374 CDD:275368 5/19 (26%)
zf-H2C2_2 367..389 CDD:290200 8/21 (38%)
C2H2 Zn finger 382..402 CDD:275368 4/19 (21%)
zf-H2C2_2 395..419 CDD:290200 10/23 (43%)
C2H2 Zn finger 410..430 CDD:275368 10/19 (53%)
C2H2 Zn finger 438..458 CDD:275368 6/20 (30%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 11/42 (26%)
COG5048 <313..471 CDD:227381 52/160 (33%)
C2H2 Zn finger 314..335 CDD:275368 6/22 (27%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
C2H2 Zn finger 371..391 CDD:275368 5/19 (26%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 10/19 (53%)
zf-H2C2_2 439..463 CDD:290200 7/23 (30%)
C2H2 Zn finger 454..475 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.