DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and zf30C

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster


Alignment Length:593 Identity:122/593 - (20%)
Similarity:193/593 - (32%) Gaps:191/593 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DTYAGMANAKCGEIYFQSLHSFRIDCAFCEMKSFVFGDFLLHVQNIHFENGLLKTEATDAGANLK 72
            :.|......||||.......|..::|..|..:.....:...|.::.....|..:.::..:...:|
  Fly   109 EAYRRHCRTKCGEEKLPREESRPMECKCCYTRFSSASNLSKHRRSRPDTCGQPEYDSPGSSDGMK 173

  Fly    73 QERDREREPNSPVPIVAQVNPFAWYEIGGDHNEDSDDERVVLEKQDEDEDERPGRSIIKWQ-DHQ 136
            :.:...::                     |.|.|||||....|:.::.:|:.|..|.:|.: ..:
  Fly   174 KHKAFRKK---------------------DRNRDSDDEDTTSEESEDSDDDIPLASRLKTKLKQE 217

  Fly   137 SLTSES----------------------LRQVRALKVD-YKEEDSEQEECGMELDLDSEGRHSAK 178
            |..|:|                      |.....:||: :.|||.|.::..|.:..:|       
  Fly   218 SQNSDSGDECPDFEPNNSEDDADASGFQLPPPAMVKVEAFDEEDFEYQDASMYVKTES------- 275

  Fly   179 IPHSCPHCTKVYQSRKVLERHIMRQHKDTLSP----------------------DVDSEDA---- 217
                    |.::.:.|.....::....|.|.|                      :|..||.    
  Fly   276 --------TDIFSNEKDKLLDVLLNEGDGLKPFESLKVEQGAGILDEIAAVPLVEVAEEDVLELR 332

  Fly   218 ------------DYEPPKD-------------AP-----------------------------VK 228
                        ...|||:             ||                             :.
  Fly   333 GHQMEKPPGPRKRGRPPKEKIPVVKRKYRKRNAPRSPSPDDSSGTPKRVAKISKKELKERLKMIN 397

  Fly   229 SAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGG 293
            ...:.:||.||.||||.:....:||:.||...|.....||..::..|:      |||.:.:    
  Fly   398 KMEKSWKCPHCVKIYHIRKPYEKHLRDDHKLNEAEMKEIFKDVDVHAK------LDEEVFK---- 452

  Fly   294 AACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIR--------------------- 337
              |.:|.:.|.....|..|...|..:..:....|.....||..:                     
  Fly   453 --CPICSKIYLVEKRLVTHMKVHGEDGKLTFKCPCYCNLFFATKEQATEHARAQHKELLYCEKCD 515

  Fly   338 -----------HMRN-HGK--VHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERP-FGCQVCDK 387
                       |.|| |.|  ..::|:|.:|:.||.....:.:|..|:||..|..| :||.||.|
  Fly   516 KYMTGHDSLKNHERNFHSKKEPRSQQRNLICDKCGKKFTGRTSLSDHVRSDCGRLPLYGCSVCGK 580

  Fly   388 RFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLY--HHKFLHADTKQFVCKLCGNAYAQAAG 450
            ...:...|:.||.:|..:.|:.|..||.|| :.|..|  |.|..|.|.|.:.|.||...|.....
  Fly   581 HLSTAGILKTHMLLHKADTPYQCDKCGKTF-KVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRES 644

  Fly   451 LAGHMRKH 458
            |..||..|
  Fly   645 LLTHMTVH 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 5/19 (26%)
zf-C2H2_8 323..411 CDD:292531 29/123 (24%)
C2H2 Zn finger 327..346 CDD:275368 8/53 (15%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 367..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-H2C2_2 395..419 CDD:290200 10/23 (43%)
C2H2 Zn finger 410..430 CDD:275368 9/21 (43%)
C2H2 Zn finger 438..458 CDD:275368 7/19 (37%)
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368 1/7 (14%)
C2H2 Zn finger 134..152 CDD:275368 3/17 (18%)
C2H2 Zn finger 511..532 CDD:275370 3/20 (15%)
COG5048 <523..>672 CDD:227381 46/131 (35%)
C2H2 Zn finger 546..566 CDD:275368 6/19 (32%)
C2H2 Zn finger 575..595 CDD:275368 7/19 (37%)
C2H2 Zn finger 603..624 CDD:275368 9/21 (43%)
C2H2 Zn finger 632..652 CDD:275368 7/19 (37%)
C2H2 Zn finger 660..680 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.