DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and ZNF181

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_016882229.1 Gene:ZNF181 / 339318 HGNCID:12971 Length:585 Species:Homo sapiens


Alignment Length:412 Identity:105/412 - (25%)
Similarity:161/412 - (39%) Gaps:93/412 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GGDHNEDSDDERVVLEKQDEDEDERPGRSIIKWQD--------HQSLTSESLRQVRALKVDY--- 153
            |..|..|      :|:|      ..|.:|:||.:.        :.:.:..:..|.::|.:..   
Human   194 GNSHKYD------ILKK------NLPKKSVIKNEKVNGGKKLLNSNKSGAAFSQGKSLTLPQTCN 246

  Fly   154 KEEDSEQEECGMELD----LDSEGR-HSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVD 213
            :|:.....|||....    |:...| |:.:.|:.|..|.|.:.....|.||::..          
Human   247 REKIYTCSECGKAFGKQSILNRHWRIHTGEKPYECRECGKTFSHGSSLTRHLISH---------- 301

  Fly   214 SEDADYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLP 278
                           |..:.|||..|||.:....||..|      .....|...:.|:.|.....
Human   302 ---------------SGEKPYKCIECGKAFSHVSSLTNH------QSTHTGEKPYECMNCGKSFS 345

  Fly   279 RLRLLDEHMVQAHGGA---ACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRF----FTI 336
            |:..|.||: :.|...   .|.:||:.:..|..|..||..||.|:...|..  |||.|    ...
Human   346 RVSHLIEHL-RIHTQEKLYECRICGKAFIHRSSLIHHQKIHTGEKPYECRE--CGKAFCCSSHLT 407

  Fly   337 RHMR------------------------NHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGE 377
            ||.|                        .|..:|||:|.|.|:.|..|....|:|.:|:|:|...
Human   408 RHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRL 472

  Fly   378 RPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCG 442
            :|:.|.:|.|.|...|.|.:|..:|:.|:|:.|..||.|||....|..|:.:|...|.:.|..||
Human   473 KPYECSICGKAFSHRSSLLQHHRIHTGEKPYECIKCGKTFSCSSNLTVHQRIHTGEKPYKCNECG 537

  Fly   443 NAYAQAAGLAGHMRKHRNDELN 464
            .|:::.:.|..|.|.|..::.|
Human   538 KAFSKGSNLTAHQRVHNGEKPN 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 7/19 (37%)
zf-C2H2_8 323..411 CDD:292531 33/115 (29%)
C2H2 Zn finger 327..346 CDD:275368 8/46 (17%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 367..389 CDD:290200 8/21 (38%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-H2C2_2 395..419 CDD:290200 10/23 (43%)
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
C2H2 Zn finger 438..458 CDD:275368 7/19 (37%)
ZNF181XP_016882229.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.