DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and Kr-h1

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:477 Identity:107/477 - (22%)
Similarity:167/477 - (35%) Gaps:148/477 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LLKTEATDAGANLKQERDREREPNSPVPIVAQ-------VNPFAWYEIGG--DHNE---DSDDER 111
            |:|||.:.......|         .|.|:.|.       |.|     .||  :|.|   .....:
  Fly    64 LIKTEQSSQAQFCLQ---------VPPPLTATTTSVGLGVPP-----SGGQQEHFELLQTPQQRQ 114

  Fly   112 VVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEEDSEQEECGMELDLDSEGRHS 176
            :.|:.||:.:           |:.|...|..|    |::...|::..:|.|              
  Fly   115 MQLQLQDQHQ-----------QEQQQFVSYQL----AIQQHQKQQQQQQHE-------------- 150

  Fly   177 AKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEP----PKDAPVKSAAQ----- 232
             .|.::.|                      |.:|  .::....||    |..|.|.|..:     
  Fly   151 -SITNAAP----------------------TAAP--SAQRIKTEPVGGFPASAAVVSQVRKPSAS 190

  Fly   233 --EYKCEHCGKIYHGKYSLRQHLK---RDHD---NGEEGGSAIFTCLECEAQL------------ 277
              ::||:.||..:..|.:...|.|   ::.|   ||..|............:|            
  Fly   191 KPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKS 255

  Fly   278 PRLRLLDEHMVQAHGGA---ACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHM 339
            |.::.|    .....||   .|.||.:.:.....|.||...||.||...|..  |.|.|....::
  Fly   256 PTIKPL----ANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEF--CHKLFSVKENL 314

  Fly   340 RNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHST 404
            :.|.::||:::.:.|:.||.:..:...|..|:|.||||||..|.||:|.|.....|..||..|:.
  Fly   315 QVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTG 379

  Fly   405 ERPHVCSV--CGATFSRQKGL------------YH----------------HKFLHADTKQFVCK 439
            |:|:.|..  ||..|:..|.|            ||                |:..|..:|.:.|.
  Fly   380 EKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCT 444

  Fly   440 LCGNAYAQAAGLAGHMRKHRND 461
            :|...:.....:..|::.|.|:
  Fly   445 ICDETFKNKKEMEAHIKGHANE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 6/19 (32%)
zf-C2H2_8 323..411 CDD:292531 30/87 (34%)
C2H2 Zn finger 327..346 CDD:275368 4/18 (22%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 367..389 CDD:290200 13/21 (62%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
zf-H2C2_2 395..419 CDD:290200 10/25 (40%)
C2H2 Zn finger 410..430 CDD:275368 9/49 (18%)
C2H2 Zn finger 438..458 CDD:275368 3/19 (16%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 6/19 (32%)
COG5048 <270..420 CDD:227381 48/151 (32%)
zf-C2H2 271..293 CDD:278523 6/21 (29%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..309 CDD:290200 10/24 (42%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)
zf-H2C2_2 313..338 CDD:290200 6/24 (25%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 13/21 (62%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 370..396 CDD:290200 10/25 (40%)
C2H2 Zn finger 385..407 CDD:275368 6/21 (29%)
zf-H2C2_2 400..424 CDD:290200 3/23 (13%)
C2H2 Zn finger 415..435 CDD:275368 1/19 (5%)
zf-C2H2 441..463 CDD:278523 3/21 (14%)
C2H2 Zn finger 443..463 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.