DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG3407

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_608809.1 Gene:CG3407 / 33606 FlyBaseID:FBgn0031573 Length:714 Species:Drosophila melanogaster


Alignment Length:390 Identity:83/390 - (21%)
Similarity:134/390 - (34%) Gaps:129/390 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HVQNIHFENGLLKTEATDAGANLKQERDRER--EPNS-------------PVPIVAQVNPFAWYE 98
            ||.: |.....|..|..|.....|.|:...:  |||.             |:|.|...|      
  Fly   370 HVGD-HMALDFLSPEKADPQEEAKLEKTLSKACEPNEQTLLVAPPACQTPPIPTVPPAN------ 427

  Fly    99 IGGDHNEDSDDERVVLE-----KQDEDE--DERPGRSIIKWQDHQSLTSESLRQVRALKVDYKEE 156
                 :......|..||     |.:||:  |.||..|                        ::|.
  Fly   428 -----SSIEQLRRSPLELSEAFKLEEDDMTDSRPASS------------------------FEEG 463

  Fly   157 DSEQEECG-------MELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDS 214
            |.:.||..       ::..|..|..:..:..|.|..|.:.:.|...|:.|....:::        
  Fly   464 DPDAEEPNECFQMEVLDTSLTEEAENKTRRKHFCDKCNRDFNSYNALKYHQYTHNQE-------- 520

  Fly   215 EDADYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPR 279
                             :.:||:.|.:.::.:.:|:.| :|.|     .|...|.|.:||.|..:
  Fly   521 -----------------RSHKCDSCERSFYTQSALKAH-ERTH-----SGVKPFKCDKCEFQFRQ 562

  Fly   280 LRLLDEHMVQAHGGA---ACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRN 341
            ...|..|::..|...   .|..||:.:..|:.|..|:                            
  Fly   563 WGDLKYHIISRHSDVKAHMCEFCGKSFSRRYSLVVHR---------------------------- 599

  Fly   342 HGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTER 406
              ::||.:||:.|:.|..:.|....|..||:.||||||:.|.:|:|:|.....|:.|..:|...|
  Fly   600 --RIHTREKNYACQYCDKTFRASSYLLSHIKVHTGERPYECSICEKKFRVSGDLKRHSRIHDPSR 662

  Fly   407  406
              Fly   663  662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 6/19 (32%)
zf-C2H2_8 323..411 CDD:292531 24/84 (29%)
C2H2 Zn finger 327..346 CDD:275368 0/18 (0%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 367..389 CDD:290200 12/21 (57%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 395..419 CDD:290200 4/12 (33%)
C2H2 Zn finger 410..430 CDD:275368
C2H2 Zn finger 438..458 CDD:275368
CG3407NP_608809.1 COG5048 <494..656 CDD:227381 50/222 (23%)
C2H2 Zn finger 497..517 CDD:275368 5/19 (26%)
zf-H2C2_2 509..534 CDD:290200 5/49 (10%)
C2H2 Zn finger 525..545 CDD:275368 5/20 (25%)
zf-H2C2_2 537..562 CDD:290200 10/30 (33%)
C2H2 Zn finger 555..574 CDD:275371 5/18 (28%)
zf-C2H2 580..602 CDD:278523 6/51 (12%)
C2H2 Zn finger 582..602 CDD:275368 6/49 (12%)
zf-H2C2_2 594..617 CDD:290200 8/52 (15%)
C2H2 Zn finger 610..630 CDD:275368 6/19 (32%)
zf-H2C2_2 622..645 CDD:290200 12/22 (55%)
zf-C2H2 636..658 CDD:278523 6/21 (29%)
C2H2 Zn finger 638..658 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.