DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG11696

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:454 Identity:109/454 - (24%)
Similarity:167/454 - (36%) Gaps:88/454 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VQNIH------FENGLLKTEATDAGANLKQERDREREPNSPVPIVAQVNPFAWYEIGGDHNEDSD 108
            :|..|      :|....:.:|.....:|::.|.|:||..         ...|..|...|.:||.:
  Fly   182 LQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELK---------RSSAGAEDDQDGDEDEE 237

  Fly   109 DERVVLEKQDEDEDERP------GRSIIK---WQDHQSLTSESLRQVRALKVDYKEEDS------ 158
            ||..|..:...|.||:|      ||...|   ..|....|||    |...:...||.|.      
  Fly   238 DEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSE----VPVKRSSIKEMDDYIAANV 298

  Fly   159 --EQEECGMELDLDSEGRHSAKIPHSCPH----CTKVYQSRKVLERHIMRQHKDTLSPDVDSEDA 217
              :...|...|:..::.:...::.|.|..    |...|:.|.:...| :..|||           
  Fly   299 KLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDH-LHCHKD----------- 351

  Fly   218 DYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRL 282
                         .|.:.|:.|.|.:..:.|...|:.|.|...:|   .:..|..|||:..:..|
  Fly   352 -------------PQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQE---LVHQCAICEARFAKKFL 400

  Fly   283 LDEHMVQAHGGA----ACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRF-----FTIRH 338
            |..|: :.|.|.    .|..|.:.::|:.||..|..:..:....|.....||..|     |.|..
  Fly   401 LTMHL-KGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHK 464

  Fly   339 MRNH--GKVHTEQKNFVCESCGYSCRNKETLRVHIRSH---TGERPFGCQVCDKRFPSHSGLREH 398
            ...|  |.|...|    |..||...|::.:||.|:..|   .|:..:.|.:|:....|.:.|..|
  Fly   465 KALHPDGPVAEVQ----CTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSH 525

  Fly   399 MAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRK-HRND 461
            |..|.:.:.|.||:|...|...:.|..|...|.....:.|:.|...:...|.:..|.:| |.||
  Fly   526 MRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKMHPND 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 6/19 (32%)
zf-C2H2_8 323..411 CDD:292531 27/97 (28%)
C2H2 Zn finger 327..346 CDD:275368 7/25 (28%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 367..389 CDD:290200 7/24 (29%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 395..419 CDD:290200 9/23 (39%)
C2H2 Zn finger 410..430 CDD:275368 6/19 (32%)
C2H2 Zn finger 438..458 CDD:275368 5/20 (25%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 4/17 (24%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 7/20 (35%)
C2H2 Zn finger 417..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..583 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.