DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG10959

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:478 Identity:161/478 - (33%)
Similarity:226/478 - (47%) Gaps:114/478 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KCGEIYFQ-SLHSFRIDCAFCEMKSFVFGDFLLHVQNIHFENGLLKTEATDAGANLKQERDRERE 80
            |||||::: ..:.|::.|..|:||.|.|.||..|::|:||:               ||.|     
  Fly    23 KCGEIFYEPEANRFQLVCLLCDMKHFGFEDFARHIRNVHFD---------------KQGR----- 67

  Fly    81 PNSPVPIVAQVNPFAWYEIGGDHNEDSDDERVVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQ 145
                 |:...|...                               ||...:.|:.|.:::|.| .
  Fly    68 -----PLTKTVTGL-------------------------------GRLAREEQEFQGVSAEPL-A 95

  Fly   146 VRALKVDY--------KEEDSEQEECGMELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMR 202
            |.:.|.:|        :|||:|| |.|:|.|   ||.         |....|...::.::...: 
  Fly    96 VDSFKKEYLPNEDVLSEEEDAEQ-ELGLEQD---EGN---------PLRIMVLGGKQSVDEETI- 146

  Fly   203 QHKDTL-SPDVDSEDA------------------DYEPPKDAPVKSAA-------QEYKCEHCGK 241
               ||: .||.||..|                  ||:|.:|.....:.       ::|.|.||.:
  Fly   147 ---DTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEHQSVFKKQRQPKDYNCPHCDR 208

  Fly   242 IYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYKTR 306
            .|..:..|..|||..|...:     .|.|::|:|.....|.|.:|..:.|...||.:|.:.:|:.
  Fly   209 RYTTQKYLNTHLKMSHPFPQ-----AFKCVDCKATFDVDRALAQHRRKEHTEFACQLCDKVFKSS 268

  Fly   307 HELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHI 371
            ..|.||...|:..|...|.|..|||.|....::.:|.:||:|::|:|||.|||..|.:|.|.||.
  Fly   269 RSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELCGYRSRYREALIVHR 333

  Fly   372 RSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQF 436
            |:||||:||.||.|.:||.|.|.|.||.||||||:|:.|..|.:.|||.|.|||||.||...|:|
  Fly   334 RTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIKKF 398

  Fly   437 VCKLCGNAYAQAAGLAGHMRKHR 459
            .||:|||||||||||:.|||.|:
  Fly   399 KCKICGNAYAQAAGLSAHMRAHK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 6/19 (32%)
zf-C2H2_8 323..411 CDD:292531 46/87 (53%)
C2H2 Zn finger 327..346 CDD:275368 5/18 (28%)
C2H2 Zn finger 354..374 CDD:275368 11/19 (58%)
zf-H2C2_2 367..389 CDD:290200 13/21 (62%)
C2H2 Zn finger 382..402 CDD:275368 11/19 (58%)
zf-H2C2_2 395..419 CDD:290200 13/23 (57%)
C2H2 Zn finger 410..430 CDD:275368 11/19 (58%)
C2H2 Zn finger 438..458 CDD:275368 16/19 (84%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 6/20 (30%)
COG5048 <258..416 CDD:227381 82/157 (52%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 316..336 CDD:275368 11/19 (58%)
zf-H2C2_2 328..353 CDD:290200 15/24 (63%)
C2H2 Zn finger 344..364 CDD:275368 11/19 (58%)
zf-H2C2_2 357..381 CDD:290200 13/23 (57%)
C2H2 Zn finger 372..392 CDD:275368 11/19 (58%)
C2H2 Zn finger 400..420 CDD:275368 16/19 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.