DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and CG12219

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_572312.1 Gene:CG12219 / 31572 FlyBaseID:FBgn0043796 Length:562 Species:Drosophila melanogaster


Alignment Length:445 Identity:88/445 - (19%)
Similarity:128/445 - (28%) Gaps:142/445 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IDCAFCEMKSFVFGDFLLHVQNIHFENGLLKTEATDAG-ANLKQERDREREPNSPVPIVA----- 89
            |.|.:|||......:...||::.|....|...|..||. :|.......|..|...||:.|     
  Fly   166 IACPYCEMAFRCRSNMYTHVKSKHTTQWLKAREERDAAKSNQNHTTPEETAPAVLVPVPAPAPAL 230

  Fly    90 ------------QVNPFAWYEIGGDHNEDSDDERVVLEKQDEDEDERPGRSIIKWQDHQSLTSES 142
                        .|||.|                          ...|..|.....:..:....|
  Fly   231 ASAPASSASPGNTVNPAA--------------------------TATPASSATPTTNLAAAPLPS 269

  Fly   143 LRQVRALKVD-YKEEDSEQEECGMELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKD 206
            ...|:.|.:. .|.:.||    .|.|.:       .|.|.|....::...||:  :.|..::.:.
  Fly   270 PPTVQQLPLSVIKSQPSE----AMNLTI-------TKTPPSGSRGSRNRSSRR--KTHSPKKVQH 321

  Fly   207 TLSPDVDSED-------------ADYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHD 258
            |...||..||             |:|.....|.|.:|:.      .|.......||:|.|     
  Fly   322 TEGSDVSDEDSPQKRLKENELILANYNAVAAAVVAAASL------TGNPPGQPDSLQQRL----- 375

  Fly   259 NGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAACVVCGRRYKT-----------RHELKRH 312
                          |.:.|.:........|.:...||....|....|           .|....|
  Fly   376 --------------CASLLQQQHQEQLFAVMSATAAAAAAVGTSSATTTTTTTTGTMMAHPYGNH 426

  Fly   313 QLKHTSERNVPCPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCG------YSCRNKETLRVHI 371
            ....|.:|      |....:          ..:|....:.:|.:||      :.|.:|.      
  Fly   427 PPSETDKR------PAAPLQ----------AVIHAAPVSIICPNCGELPGQNHRCLSKP------ 469

  Fly   372 RSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHH 426
                   .:.|.||.|.|.....|.||.|.|:..:.|.|:.|...|..:..:|||
  Fly   470 -------KYACDVCGKSFKMKRYLEEHFATHTGVKLHTCAFCPTEFRSKSNMYHH 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 4/30 (13%)
zf-C2H2_8 323..411 CDD:292531 18/93 (19%)
C2H2 Zn finger 327..346 CDD:275368 1/18 (6%)
C2H2 Zn finger 354..374 CDD:275368 5/25 (20%)
zf-H2C2_2 367..389 CDD:290200 4/21 (19%)
C2H2 Zn finger 382..402 CDD:275368 9/19 (47%)
zf-H2C2_2 395..419 CDD:290200 9/23 (39%)
C2H2 Zn finger 410..430 CDD:275368 6/17 (35%)
C2H2 Zn finger 438..458 CDD:275368
CG12219NP_572312.1 zf-AD 2..94 CDD:285071
C2H2 Zn finger 140..160 CDD:275368
COG4049 149..204 CDD:226535 12/37 (32%)
C2H2 Zn finger 168..186 CDD:275368 5/17 (29%)
C2H2 Zn finger 473..493 CDD:275370 9/19 (47%)
C2H2 Zn finger 501..522 CDD:275370 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.