DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and mld

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster


Alignment Length:536 Identity:97/536 - (18%)
Similarity:161/536 - (30%) Gaps:197/536 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LHVQNIHF-----ENGLLKTEATDAGANLKQERDREREPNSPVPIVAQVNPFAWYEIGGDHNEDS 107
            :|:|..|.     .:|.:|.|  |....:..||.....|..|...:.|            |....
  Fly  1439 VHIQRFHMTLKTDPSGAVKVE--DVQLQITSERRPRGRPYKPRLQLQQ------------HQLQP 1489

  Fly   108 DDERVVLEKQDEDEDERPGRSIIKWQDHQ-----SLTSESLRQVRALKVDYKEEDSEQEECGMEL 167
            ..:   |:.|...:.::..:.:.:.|.||     .|..|.|:||:.|:|..:.:..:|.:..:::
  Fly  1490 QQK---LQVQQHQQQQKALQQLPQAQHHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQVLQV 1551

  Fly   168 D-------LDSEGRHSAKI--------PHS---CP----------HCTKVYQSRKVLE------- 197
            .       :..:..|.:.:        |..   ||          |..:.::..:.|:       
  Fly  1552 QQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHSHANEQFEELQTLQAPPTVLT 1616

  Fly   198 -----------------RHI---------------MRQHK------------------------- 205
                             :||               :||::                         
  Fly  1617 PPSTIVSVPSPQPMVYSQHITMPSPEQSEPDSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSS 1681

  Fly   206 -------DTLSPDVDSEDADYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEG 263
                   |.:.|...:..|...||....|.|..|.                 ..|:..|.     
  Fly  1682 SPSSSTVDHIPPASPATPASPAPPPSPAVASTVQV-----------------SELRTSHH----- 1724

  Fly   264 GSAIFTCLECEAQLPRLRLLDEHMVQAHGGA-----ACVVCGRRYKTRHELKRHQLKHTSERNVP 323
                  ||.||.:......|.:|...|||..     .|.:|.|.|:.|..|.||...|       
  Fly  1725 ------CLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHMESH------- 1776

  Fly   324 CPHPGCGKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVH-IRSHTGERPFGCQVCDK 387
                                  ..|.:.:.|..|.........|.:| |..|...:|..|..|.|
  Fly  1777 ----------------------DVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGK 1819

  Fly   388 RFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLA 452
            :|.:.|.|:.|:..|. |..:.|..|..||...|.|..|:..|:: ..:.||.|.:::.:.....
  Fly  1820 QFGTESALKTHIKFHG-ELGYQCDGCDRTFEYLKELRKHRRTHSE-MFYKCKFCPSSFMRFTNFR 1882

  Fly   453 GHMRKH------RNDE 462
            .||:.|      ||::
  Fly  1883 AHMKTHLPLGVFRNED 1898

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 8/19 (42%)
zf-C2H2_8 323..411 CDD:292531 17/88 (19%)
C2H2 Zn finger 327..346 CDD:275368 0/18 (0%)
C2H2 Zn finger 354..374 CDD:275368 5/20 (25%)
zf-H2C2_2 367..389 CDD:290200 8/22 (36%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-H2C2_2 395..419 CDD:290200 8/23 (35%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 438..458 CDD:275368 5/19 (26%)
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368 2/5 (40%)
C2H2 Zn finger 1725..1746 CDD:275368 6/20 (30%)
C2H2 Zn finger 1756..1776 CDD:275368 8/19 (42%)
C2H2 Zn finger 1785..1806 CDD:275368 5/20 (25%)
C2H2 Zn finger 1814..1834 CDD:275368 7/19 (37%)
zf-C2H2 1839..1861 CDD:278523 7/21 (33%)
C2H2 Zn finger 1841..1861 CDD:275368 7/19 (37%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.