DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2129 and pag-3

DIOPT Version :9

Sequence 1:	NP_572449.1	Gene:	CG2129 / 31741	FlyBaseID:	FBgn0030008	Length:	465	Species:	Drosophila melanogaster
Sequence 2:	NP_510480.1	Gene:	pag-3 / 181588	WormBaseID:	WBGene00003909	Length:	336	Species:	Caenorhabditis elegans

Alignment Length:	130	Identity:	46/130 - (35%)
Similarity:	66/130 - (50%)	Gaps:	0/130 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   329 CGKRFFTIRHMRNHGKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHS 393
            |.|.|.||..:..|.:||...|.|.|:.||.:.:...||..|:..|:..||:.|:.|.|||...|
Worm   131 CTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKS 195

  Fly   394 GLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLHADTKQFVCKLCGNAYAQAAGLAGHMRKH 458
            .:::|..:|:.|:||.|:|||..||:...|..|...|...|.|.|.:||..:.:......|...|
Worm   196 DMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESH 260

Fly 459 458
Worm 261 260

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2129	NP_572449.1	C2H2 Zn finger	296..316	CDD:275370
		zf-C2H2_8	323..411	CDD:292531	30/81 (37%)
		C2H2 Zn finger	327..346	CDD:275368	6/16 (38%)
		C2H2 Zn finger	354..374	CDD:275368	6/19 (32%)
		zf-H2C2_2	367..389	CDD:290200	8/21 (38%)
		C2H2 Zn finger	382..402	CDD:275368	7/19 (37%)
		zf-H2C2_2	395..419	CDD:290200	10/23 (43%)
		C2H2 Zn finger	410..430	CDD:275368	8/19 (42%)
		C2H2 Zn finger	438..458	CDD:275368	4/19 (21%)
pag-3	NP_510480.1	C2H2 Zn finger	128..148	CDD:275368	6/16 (38%)
		zf-H2C2_2	140..165	CDD:290200	8/24 (33%)
		zf-C2H2	154..176	CDD:278523	7/21 (33%)
		C2H2 Zn finger	156..176	CDD:275368	6/19 (32%)
		COG5048	164..>233	CDD:227381	25/68 (37%)
		zf-H2C2_2	169..193	CDD:290200	10/23 (43%)
		C2H2 Zn finger	184..204	CDD:275368	7/19 (37%)
		zf-H2C2_2	196..221	CDD:290200	10/24 (42%)
		C2H2 Zn finger	212..232	CDD:275368	8/19 (42%)
		zf-H2C2_2	224..247	CDD:290200	8/22 (36%)
		C2H2 Zn finger	240..260	CDD:275368	4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910