DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and ZNF688

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_024305933.1 Gene:ZNF688 / 146542 HGNCID:30489 Length:384 Species:Homo sapiens


Alignment Length:58 Identity:22/58 - (37%)
Similarity:30/58 - (51%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 SHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYHHKFLH 430
            :..|:|...|..|.:||...|.|..|..|||.|||..|..||..|.|:..:..|:::|
Human   284 AQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIH 341

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370
zf-C2H2_8 323..411 CDD:292531 15/37 (41%)
C2H2 Zn finger 327..346 CDD:275368