DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and ZFP92

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001129745.1 Gene:ZFP92 / 139735 HGNCID:12865 Length:416 Species:Homo sapiens


Alignment Length:348 Identity:93/348 - (26%)
Similarity:139/348 - (39%) Gaps:52/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PIVAQVNPFAWYEIGGDHNEDSDDERVVLEKQDEDEDERPGRSIIKWQDHQSLTSESLRQVRALK 150
            |.||.: |..| ...|.|..|....:.....|.....:.||......::.|:..|..|::     
Human    72 PWVADI-PRTW-ATAGLHIGDRTQSKTSTSTQKHSGRQLPGADPQGGKEGQAARSSVLQR----- 129

  Fly   151 VDYKEEDSEQEECGMELDLDSEGRHSAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSE 215
                    ..:..|.......:|...|:..:.|..|.|.:.....|.:|.:              
Human   130 --------GAQGLGQSSAAGPQGPKGAEKRYLCQQCGKAFSRSSNLIKHRI-------------- 172

  Fly   216 DADYEPPKDAPVKSAAQEYKCEHCGKIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRL 280
                       :.|..:.|.|..|||::...::|.:| :|.|     .|...:.|.||.....|.
Human   173 -----------IHSGEKPYACPECGKLFRRSFALLEH-QRIH-----SGEKPYACPECSKTFTRS 220

  Fly   281 RLLDEHMVQAHGGA---ACVVCGRRYKTRHELKRHQLKHTSERNVPCPHPGCGKRFFTIRHMRNH 342
            ..|.:|.| .|.|.   ||..||:.::....|..|...|:.||...||.  |||.|....::..|
Human   221 SNLIKHQV-IHSGERPFACGDCGKLFRRSFALLEHARVHSGERPYACPE--CGKAFSRSSNLIEH 282

  Fly   343 GKVHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHSTERP 407
            .:.|..:|.:.|..|..:.:....|..|.|||:|||||.|:.|.|.|...|||.:|..:||.|:|
Human   283 QRTHRGEKPYACGQCAKAFKGVSQLIHHQRSHSGERPFACRECGKAFRGRSGLSQHRRVHSGEKP 347

  Fly   408 HVCSVCGATFSRQKGLYHHKFLH 430
            :.||.||..|.|:..|:.|:.:|
Human   348 YECSDCGKAFGRRANLFKHQAVH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 5/19 (26%)
zf-C2H2_8 323..411 CDD:292531 33/87 (38%)
C2H2 Zn finger 327..346 CDD:275368 5/18 (28%)
C2H2 Zn finger 354..374 CDD:275368 5/19 (26%)
zf-H2C2_2 367..389 CDD:290200 13/21 (62%)
C2H2 Zn finger 382..402 CDD:275368 8/19 (42%)
zf-H2C2_2 395..419 CDD:290200 11/23 (48%)
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
C2H2 Zn finger 438..458 CDD:275368
ZFP92NP_001129745.1 KRAB 14..74 CDD:214630 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..125 6/38 (16%)
COG5048 <145..286 CDD:227381 42/174 (24%)
C2H2 Zn finger 154..174 CDD:275368 5/44 (11%)
C2H2 Zn finger 182..202 CDD:275368 7/20 (35%)
C2H2 Zn finger 210..230 CDD:275368 7/20 (35%)
C2H2 Zn finger 238..258 CDD:275368 5/19 (26%)
COG5048 262..>315 CDD:227381 16/54 (30%)
C2H2 Zn finger 266..286 CDD:275368 7/21 (33%)
C2H2 Zn finger 294..314 CDD:275368 5/19 (26%)
C2H2 Zn finger 322..342 CDD:275368 8/19 (42%)
zf-H2C2_2 335..359 CDD:404364 11/23 (48%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..416 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.