DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2129 and LOC102554302

DIOPT Version :9

Sequence 1:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_006230434.1 Gene:LOC102554302 / 102554302 RGDID:7506689 Length:275 Species:Rattus norvegicus


Alignment Length:78 Identity:25/78 - (32%)
Similarity:34/78 - (43%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 VHTEQKNFVCESCGYSCRNKETLRVHIRSHTGERPFGCQVCDKRFPSHSGLREHMAMHST----- 404
            :...|:..||..||........|..|.|.|:|||||.|..|..||.....::.|..:|.:     
  Rat   175 IQPSQRRHVCVDCGRRFTYPSLLISHRRMHSGERPFPCPECGVRFKRKFAVKAHQWIHRSCSGGR 239

  Fly   405 --ERPHVCSVCGA 415
              .||.:.:|.||
  Rat   240 RGRRPGIRAVPGA 252

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370
zf-C2H2_8 323..411 CDD:292531 22/72 (31%)