DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-PheRS and FDXACB1

DIOPT Version :9

Sequence 1:NP_572448.1 Gene:alpha-PheRS / 31740 FlyBaseID:FBgn0030007 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_612387.1 Gene:FDXACB1 / 91893 HGNCID:25110 Length:624 Species:Homo sapiens


Alignment Length:225 Identity:42/225 - (18%)
Similarity:76/225 - (33%) Gaps:59/225 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LLQETTTKSFVLARGPEFATTLTKLETDLTVEMLANGLWDQLKFKAYNFD-------ALGAPPTR 220
            ||.:|..:|             :||.:.:...:.:||....::.|.:||.       .:|:..|.
Human   422 LLTQTLPES-------------SKLSSLVKFVLQSNGKDYMIRVKTHNFSPDCTEDLIIGSVITS 473

  Fly   221 GHLHPLLKVRTEFRQIFLEMGFSEMPTNNYVESSF---WNFDALYQPQQHPARDAHDTFFVNHPA 282
            .    ...:..:...:|:.|....:....:..|.:   |.||..:.....|.:        ..|.
Human   474 A----TSVIHKDQCFVFVSMNLDLLAMLVWCISDWRMLWTFDNRFLKNFVPGK--------IEPF 526

  Fly   283 KSHK-FPQDYLERVKKVHSVGGYGSKGYGYDWKLE-------EAQKNLLR-------THTTAVSA 332
            |||. :|..|      ||.|..:..:..|:| :||       .:|..::.       .|......
Human   527 KSHSLYPPCY------VHDVSFWIDQKKGFD-ELEFHTVARAVSQDTIISIQFLSRFQHPKTQQV 584

  Fly   333 RMLYKLANQ--EGGFKAAKYFSIDKVFRNE 360
            .:.|:|..|  :......:..|:...||.|
Human   585 SLCYRLTYQTCDKALTQQQVASMQSQFRKE 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-PheRSNP_572448.1 PLN02853 4..496 CDD:215458 42/225 (19%)
PheRS_alpha_core 224..483 CDD:238277 29/157 (18%)
FDXACB1NP_612387.1 DUF2431 7..176 CDD:287341
FDX-ACB 530..624 CDD:214893 18/92 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.