DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-PheRS and fars2

DIOPT Version :9

Sequence 1:NP_572448.1 Gene:alpha-PheRS / 31740 FlyBaseID:FBgn0030007 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001099064.1 Gene:fars2 / 793097 ZFINID:ZDB-GENE-070928-38 Length:449 Species:Danio rerio


Alignment Length:304 Identity:72/304 - (23%)
Similarity:111/304 - (36%) Gaps:101/304 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 RGHLHPLLKVRTEFRQIFLE--MG------FSEMPTNNYVESSFWNFDALYQPQQHPARDAHDTF 276
            |.| |||..::...:..|..  :|      ||.......|.:...|||:|..|..||:....:.:
Zfish    78 RPH-HPLWLIKERIKDHFYRSYVGRTGNPIFSVHDNLRPVVTVEQNFDSLLIPADHPSCKKGENY 141

  Fly   277 FVNHPAKSHKFPQDYLERVKKVHSVGGYGSKGYGYDWKLEEAQKNLLRTHTTAVSARMLYKLANQ 341
            ::|   ::|                                    :||.||:|....::      
Zfish   142 YLN---RTH------------------------------------MLRAHTSAHQKELV------ 161

  Fly   342 EGGFKAAKYFSIDKVFRNETLDATHLAEFHQVEGV--------IADV----GLTLGDLIG----- 389
            ..|...  :.....|:|.:.:|::|...|||:|||        .|.|    .|:|.:..|     
Zfish   162 RSGLDC--FLLAGDVYRRDEVDSSHYPVFHQMEGVRLFSNHELFAGVENGEDLSLFERGGRRTPQ 224

  Fly   390 ----------TLYEFFRKLGITQL-----------EFKPAYNPYTEPSMEIFCYHPGLAKWIEVG 433
                      .|.||..|..:|:|           .:...|.|:|.||.|:..:..|  .|:||.
Zfish   225 KQETHTLEAVKLLEFDLKRALTRLVRHLFGEDLEIRWVDCYFPFTHPSFEMEVFFQG--DWMEVL 287

  Fly   434 NSGVFRPEMLLPMGLPENVNVIAW--GLSLERPTMIKYGINNIR 475
            ..||...|::...|..   |.:.|  ||.|||..|:.:||.:||
Zfish   288 GCGVMEQELVRSAGAD---NKMGWAFGLGLERLAMVLFGIPDIR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-PheRSNP_572448.1 PLN02853 4..496 CDD:215458 72/304 (24%)
PheRS_alpha_core 224..483 CDD:238277 70/300 (23%)
fars2NP_001099064.1 PLN02788 54..448 CDD:215422 72/304 (24%)
PheRS_alpha_core 81..336 CDD:238277 70/300 (23%)
FDX-ACB 356..448 CDD:214893
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.