DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-PheRS and Fdxacb1

DIOPT Version :9

Sequence 1:NP_572448.1 Gene:alpha-PheRS / 31740 FlyBaseID:FBgn0030007 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_941077.2 Gene:Fdxacb1 / 382137 MGIID:3584513 Length:622 Species:Mus musculus


Alignment Length:234 Identity:44/234 - (18%)
Similarity:74/234 - (31%) Gaps:78/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 VGFSKAMSHGWILVDKSVTPPLVRRKVDTITDVVRNQLQQVALGKGDQLPAKEVADFKKRKLLQE 166
            :||...|.       :|..|.|:....|.:.:::...||:     |..|....       :.:.:
Mouse   396 LGFDNNMK-------ESCLPSLLGHLKDALGNLLTQTLQE-----GSSLGTSV-------EFVLQ 441

  Fly   167 TTTKSFV-----LARGPEFATTLTKLETDLTVEMLANGLWDQLKFKAYNFDALGAPPTRGHLHPL 226
            ...|.::     |..||:.|..|. :.:.||.:::.: ......|.:.|.|.|            
Mouse   442 PNGKDYIIHVKSLNFGPDCAENLI-IGSILTSKIVKH-KHQCFVFVSINLDLL------------ 492

  Fly   227 LKVRTEFRQIFLEMGFSEMPTNNYVESSFWNFDALYQPQQHPARDAHDTFFVNHPAKSHK-FPQD 290
                     :.|..|.|:.       ...|.||..:..:..|.:..|        .||:. :|..
Mouse   493 ---------VMLAYGISDW-------RILWTFDNRFLKRFAPGKIEH--------FKSYSLYPPC 533

  Fly   291 YLERVKKVHSVGGYGSKGYGYDWKLEEAQKNLLRTHTTA 329
            |      ||.|.         .|..|:...:.|..||.|
Mouse   534 Y------VHDVS---------FWVDEKKAFDELEFHTVA 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-PheRSNP_572448.1 PLN02853 4..496 CDD:215458 44/234 (19%)
PheRS_alpha_core 224..483 CDD:238277 21/107 (20%)
Fdxacb1NP_941077.2 DUF2431 7..176 CDD:287341
FDX-ACB 528..622 CDD:214893 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.