DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-PheRS and Fars2

DIOPT Version :9

Sequence 1:NP_572448.1 Gene:alpha-PheRS / 31740 FlyBaseID:FBgn0030007 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_038951616.1 Gene:Fars2 / 306879 RGDID:1309416 Length:544 Species:Rattus norvegicus


Alignment Length:297 Identity:70/297 - (23%)
Similarity:115/297 - (38%) Gaps:95/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 HPLLKVRTEFRQIFLE--MGFSEMPTNNY------VESSFWNFDALYQPQQHPARDAHDTFFVNH 280
            |||..::...::.|.:  ||.|..|..:.      |.:::.|||:|..|..||:|...|.:::| 
  Rat    84 HPLWLIKERVKEHFYQQYMGRSRTPLFSVYDQLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLN- 147

  Fly   281 PAKSHKFPQDYLERVKKVHSVGGYGSKGYGYDWKLEEAQKNLLRTHTTAVSARMLYKLANQEGGF 345
                                      :|:            :||.||:|....:|:      .|.
  Rat   148 --------------------------RGH------------MLRAHTSAHQWDLLH------AGL 168

  Fly   346 KAAKYFSIDKVFRNETLDATHLAEFHQVEGV------IADVGLTLGDLIG--------------- 389
            .|  :..:..|:|.:.:|:.|...|||:|||      ....|:..|:.:.               
  Rat   169 NA--FLVVGDVYRRDQIDSQHYPVFHQLEGVRLFSKHELFAGVKDGESLQLFEESSRSAHKQETH 231

  Fly   390 -----TLYEFFRKLGITQL-----------EFKPAYNPYTEPSMEIFCYHPGLAKWIEVGNSGVF 438
                 .|.||..|..:|:|           .:...|.|:|.||.|:.....|  :|:||...||.
  Rat   232 TMEAVKLVEFDLKQVLTRLVTHLFGDGLEVRWVDCYFPFTHPSFEMEINFRG--EWLEVLGCGVM 294

  Fly   439 RPEMLLPMGLPENVNVIAWGLSLERPTMIKYGINNIR 475
            ..:::...|..:.:. .|:||.|||..|:.|.|.:||
  Rat   295 EQQLVNSAGAQDRIG-WAFGLGLERLAMVLYDIPDIR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-PheRSNP_572448.1 PLN02853 4..496 CDD:215458 70/297 (24%)
PheRS_alpha_core 224..483 CDD:238277 70/297 (24%)
Fars2XP_038951616.1 PLN02788 29..405 CDD:215422 70/297 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.