DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-PheRS and FARS2

DIOPT Version :9

Sequence 1:NP_572448.1 Gene:alpha-PheRS / 31740 FlyBaseID:FBgn0030007 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001305801.1 Gene:FARS2 / 10667 HGNCID:21062 Length:451 Species:Homo sapiens


Alignment Length:298 Identity:72/298 - (24%)
Similarity:114/298 - (38%) Gaps:97/298 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 HPLLKVRTEFRQIFLE--MG------FSEMPTNNYVESSFWNFDALYQPQQHPARDAHDTFFVNH 280
            |||..::...::.|.:  :|      ||.....:.|.:::.|||:|..|..||:|...|.:::| 
Human    84 HPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLN- 147

  Fly   281 PAKSHKFPQDYLERVKKVHSVGGYGSKGYGYDWKLEEAQKNLLRTHTTAVSARMLYKLANQEGGF 345
              ::|                                    :||.||:|....:|:      .|.
Human   148 --RTH------------------------------------MLRAHTSAHQWDLLH------AGL 168

  Fly   346 KAAKYFSIDKVFRNETLDATHLAEFHQVEGV-----------IAD-------------------- 379
            .|  :..:..|:|.:.:|:.|...|||:|.|           |.|                    
Human   169 DA--FLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGESLQLFEQSSRSAHKQETH 231

  Fly   380 ----VGLTLGDLIGTLYEFFRKLGITQLEFK--PAYNPYTEPSMEI-FCYHPGLAKWIEVGNSGV 437
                |.|...||..||......|...:||.:  ..|.|:|.||.|: ..:|   .:|:||...||
Human   232 TMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFH---GEWLEVLGCGV 293

  Fly   438 FRPEMLLPMGLPENVNVIAWGLSLERPTMIKYGINNIR 475
            ...:::...|..:.:. .|:||.|||..||.|.|.:||
Human   294 MEQQLVNSAGAQDRIG-WAFGLGLERLAMILYDIPDIR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-PheRSNP_572448.1 PLN02853 4..496 CDD:215458 72/298 (24%)
PheRS_alpha_core 224..483 CDD:238277 72/298 (24%)
FARS2NP_001305801.1 PLN02788 29..450 CDD:215422 72/298 (24%)
Substrate binding 157..160 1/2 (50%)
Substrate binding 186..188 0/1 (0%)
Substrate binding 193..195 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.