DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smox and SMAD7

DIOPT Version :9

Sequence 1:NP_001285006.1 Gene:Smox / 31738 FlyBaseID:FBgn0025800 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_005895.1 Gene:SMAD7 / 4092 HGNCID:6773 Length:426 Species:Homo sapiens


Alignment Length:458 Identity:120/458 - (26%)
Similarity:182/458 - (39%) Gaps:152/458 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KAVKNLVKKIKKNSQLEELERAISTQ-NCQTRCVTVP-----RSKP-APAGEHLRK-----GLPH 83
            ||:.:.|.|..|..|||.|.:|:.:: ..:|.|:.:|     |..| ||||....:     .|| 
Human    93 KALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLP- 156

  Fly    84 VIYCRLWRWPDLQSQNELKPLDHCEYAFHLRKEEICINPYHYKKIELSILVPKSLPTPPDSIVDY 148
            ::.|:::|||||:..:|:|.|..||....:..|.:|.||:|     ||.|.....|.||.|  .|
Human   157 LLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHH-----LSRLCELESPPPPYS--RY 214

  Fly   149 PLDNHTHQIPNNTDYNAAIIRSASLSPPQYMELGGAGPVSVSSSASSTPATAAGGGGGPSSSSSS 213
            |:|                    .|.|             .:....:.|::|..||         
Human   215 PMD--------------------FLKP-------------TADCPDAVPSSAETGG--------- 237

  Fly   214 SSSAASAYQQQQQQLSFGQNMDSQSSVLSVGSSIPNTGTPPPGYMSEDGDPIDPNDNMNMSRLTP 278
                                                |....||.:|:....::|.|.        
Human   238 ------------------------------------TNYLAPGGLSDSQLLLEPGDR-------- 258

  Fly   279 PADAAPVMYHEPAFWCSISYYELNTRVGETFHASQPSITVDGFTDPSNSERFCLGLLSNVNRNEV 343
                        :.||.::|:|..||||..:...:||:  |.|.|......||||.|::.|::::
Human   259 ------------SHWCVVAYWEEKTRVGRLYCVQEPSL--DIFYDLPQGNGFCLGQLNSDNKSQL 309

  Fly   344 VEQTRRHIGKGVRLYYIGGEVFAECLSDSSIFVQS---PNCNQRYGWHPATVCKIPPGCNLKIF- 404
            |::.|..||.|::|......|:....|...||::|   .|.:.|    ...|.|:.||.::|.| 
Human   310 VQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSR----TLLVHKVFPGFSIKAFD 370

  Fly   405 ----------NNQEFAALLSQSVSQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIEL 459
                      |:.||    .|....||          |:::|||||||..|.||.::|.|||:|:
Human   371 YEKAYSLQRPNDHEF----MQQPWTGF----------TVQISFVKGWGQCYTRQFISSCPCWLEV 421

  Fly   460 HLN 462
            ..|
Human   422 IFN 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmoxNP_001285006.1 MH1_R-SMAD 7..130 CDD:199812 37/110 (34%)
MH2_SMAD_2_3 285..475 CDD:199826 61/192 (32%)
SMAD7NP_005895.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..55
MH1_SMAD_7 60..205 CDD:199818 40/117 (34%)
Important for interaction with SMURF2 208..217 5/10 (50%)
PY-motif 208..211 1/2 (50%)
MH2_SMAD_7 254..424 CDD:199825 62/209 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3701
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.