DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF254

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_975011.3 Gene:ZNF254 / 9534 HGNCID:13047 Length:659 Species:Homo sapiens


Alignment Length:326 Identity:94/326 - (28%)
Similarity:147/326 - (45%) Gaps:63/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLEDLQLFAQLEDLSGERLPMEMELLNPGSE-YDLLELVNGALQQRNTTEHKPT-DMCKPKR--- 85
            |.|..:.|.:..:|:..:      :::.|.: |...|.....:.....||||.. ...||.:   
Human   268 CEECGEAFNRSSNLTTHK------IIHTGEKPYKCEECGKAFIWSSTLTEHKKIHTRKKPYKCEE 326

  Fly    86 -------TPTTKRHR---TTGKDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLN 140
                   :.|..||:   |..|.:.|:.|.:.||::..|..||:.||.||.:.|:||||.|:||:
Human   327 CGKAFIWSSTLTRHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKRYKCLECGKAFKQLS 391

  Fly   141 KLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSF--------HSI 197
            .|..|.:.|..|:.:||:.|||||..::.||.|:.:|||||||.|  .:|..:|        |  
Human   392 TLTTHKIIHVGEKLYKCEECGKGFNRSSNLTTHKIIHTGEKPYKC--EECGKAFIWSSTLTKH-- 452

  Fly   198 HARRIHTKLRHAAQTDPDPEHP---------------LAEQEQRDTSALSFTCPVCSRVLTDQCY 247
              :||||:           |.|               |...::..|....:.|..|.:..:....
Human   453 --KRIHTR-----------EKPYKCEECGKAFIWSSTLTRHKRMHTGEKPYKCEECGKSFSQSST 504

  Fly   248 LSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKV 312
            |:.|...|..::.:.|  .||||.|..:|.|..|:|.||:::|:.|..|...|.:.|....|.::
Human   505 LTTHKIIHTGEKPYKC--EECGKAFNWSSTLTKHKIIHTEEKPYKCEKCGKAFKQSSILTNHKRI 567

  Fly   313 H 313
            |
Human   568 H 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 7/19 (37%)
zf-H2C2_2 113..138 CDD:290200 13/24 (54%)
C2H2 Zn finger 129..149 CDD:275368 10/19 (53%)
zf-H2C2_2 142..166 CDD:290200 11/23 (48%)
COG5048 151..>264 CDD:227381 35/135 (26%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 8/28 (29%)
C2H2 Zn finger 235..255 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..285 CDD:275368 10/21 (48%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)
ZNF254NP_975011.3 KRAB 13..73 CDD:214630
C2H2 Zn finger 184..204 CDD:275368
C2H2 Zn finger 212..260 CDD:275368
COG5048 264..625 CDD:227381 94/326 (29%)
C2H2 Zn finger 268..288 CDD:275368 4/25 (16%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
C2H2 Zn finger 324..344 CDD:275368 3/19 (16%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
C2H2 Zn finger 380..400 CDD:275368 10/19 (53%)
C2H2 Zn finger 408..428 CDD:275368 9/19 (47%)
C2H2 Zn finger 436..456 CDD:275368 5/25 (20%)
C2H2 Zn finger 464..484 CDD:275368 1/19 (5%)
C2H2 Zn finger 492..512 CDD:275368 4/19 (21%)
C2H2 Zn finger 520..540 CDD:275368 10/21 (48%)
C2H2 Zn finger 548..568 CDD:275368 5/19 (26%)
C2H2 Zn finger 576..596 CDD:275368
C2H2 Zn finger 604..624 CDD:275368
C2H2 Zn finger 632..652 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.