DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF682

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_016882944.1 Gene:ZNF682 / 91120 HGNCID:28857 Length:504 Species:Homo sapiens


Alignment Length:319 Identity:101/319 - (31%)
Similarity:144/319 - (45%) Gaps:52/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGNYDVC-LEDLQLFAQLEDLSGERLPMEMELLNPGSEYDLLELVNGALQQRNTTEHK--PTDMC 81
            |..|..| ||||.|     ...||         |.|...|..|:.||..|..:|...|  |.:.|
Human   106 LRRYGSCGLEDLHL-----RKDGE---------NVGECKDQKEIYNGLNQCLSTLPSKIFPYNKC 156

  Fly    82 KPKRTPTTKRHR-----TTGKDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNK 141
            ....:.::..:|     ||.|...|..|.:.|.....|..||:.||:||..:|.||||.|:..:.
Human   157 VKVFSKSSNLNRENIRHTTEKLFKCMQCGKVFKSHSGLSYHKIIHTEEKLCICEECGKTFKWFSY 221

  Fly   142 LRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSFH----SIHARRI 202
            |..|...||.|:|:||:.|||.|.:.:.||.|:|:|||||||.|  .:|..:||    .:..::|
Human   222 LTKHKRIHTGEKPYKCEECGKAFNWCSSLTKHKRIHTGEKPYKC--EECGKAFHWCSPFVRHKKI 284

  Fly   203 HTK-------------LRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKR 254
            ||.             .||:..|.....|         |....:.|..|.:.......|:||.:.
Human   285 HTGEKPYTCEDCGRAFNRHSHLTKHKTIH---------TGKKPYKCKECGKAFNHCSLLTIHERT 340

  Fly   255 HYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKVH 313
            |..::.:.|  .||||.|.|:|.|..|::.|:.::|:.|..|...|.|.|...:|.::|
Human   341 HTGEKPYKC--EECGKAFNSSSILTEHKVIHSGEKPYKCEKCDKVFKRFSYLTKHKRIH 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 6/19 (32%)
zf-H2C2_2 113..138 CDD:290200 13/24 (54%)
C2H2 Zn finger 129..149 CDD:275368 8/19 (42%)
zf-H2C2_2 142..166 CDD:290200 12/23 (52%)
COG5048 151..>264 CDD:227381 37/129 (29%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 7/37 (19%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 10/21 (48%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
ZNF682XP_016882944.1 KRAB 10..70 CDD:214630
KRAB 10..49 CDD:279668
C2H2 Zn finger 153..173 CDD:275368 2/19 (11%)
C2H2 Zn finger 181..201 CDD:275368 6/19 (32%)
C2H2 Zn finger 209..229 CDD:275368 8/19 (42%)
zf-H2C2_2 221..245 CDD:290200 11/23 (48%)
C2H2 Zn finger 237..257 CDD:275368 9/19 (47%)
COG5048 <245..451 CDD:227381 48/166 (29%)
zf-H2C2_2 249..273 CDD:290200 13/25 (52%)
C2H2 Zn finger 265..285 CDD:275368 4/21 (19%)
zf-H2C2_2 280..302 CDD:290200 3/21 (14%)
C2H2 Zn finger 293..313 CDD:275368 3/19 (16%)
zf-H2C2_2 305..330 CDD:290200 5/33 (15%)
C2H2 Zn finger 321..341 CDD:275368 5/19 (26%)
zf-H2C2_2 334..358 CDD:290200 10/25 (40%)
C2H2 Zn finger 349..369 CDD:275368 10/21 (48%)
zf-H2C2_2 362..386 CDD:290200 7/23 (30%)
C2H2 Zn finger 377..397 CDD:275368 6/19 (32%)
zf-H2C2_2 389..413 CDD:290200 2/9 (22%)
C2H2 Zn finger 405..425 CDD:275368
zf-H2C2_2 418..442 CDD:290200
C2H2 Zn finger 433..453 CDD:275368
zf-H2C2_2 445..470 CDD:290200
C2H2 Zn finger 461..480 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.