DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF141

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_016864080.1 Gene:ZNF141 / 7700 HGNCID:12926 Length:534 Species:Homo sapiens


Alignment Length:345 Identity:101/345 - (29%)
Similarity:142/345 - (41%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGNYDVCLED-LQLFAQLEDLSGERLPMEMELLNPG-SEYDLLELVNGALQQRNTTEHKPTDMCK 82
            |..|:.|..| |||....:.|:      |.:|...| :|:      |..|   :||:.|.. .||
Human   160 LRRYEKCGHDNLQLRKGCKSLN------ECKLQKGGYNEF------NECL---STTQSKIL-QCK 208

  Fly    83 ------PKRTPTTKRH-RTTGKDH---------------------------TCDICDRRFSEAYN 113
                  .|.:.:.||. |.||:.|                           ||:.|.:.|..:..
Human   209 ASVKVVSKFSNSNKRKTRHTGEKHFKECGKSFQKFSHLTQHKVIHAGEKPYTCEECGKAFKWSLI 273

  Fly   114 LRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHT 178
            ...||..||.|||..|.|||..|...:....|.:.||.|:|:||:.|||.|.....||.|:|:|.
Human   274 FNEHKRIHTGEKPFTCEECGSIFTTSSHFAKHKIIHTGEKPYKCEECGKAFNRFTTLTKHKRIHA 338

  Fly   179 GEKPYPCLATDCHLSFHS----IHARRIHT-----------KLRHAAQTDPDPEHPLAEQEQRDT 228
            ||||..|  .:|...|.|    ...:||||           |..:.:.|       |.:.::..|
Human   339 GEKPITC--EECRKIFTSSSNFAKHKRIHTGEKPYKCEECGKAFNRSTT-------LTKHKRIHT 394

  Fly   229 SALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFAC 293
            ....:||..|.:.......|:.|.|.|..:|.:.|  .||||.|..:..|..|:..||.::|:.|
Human   395 GEKPYTCEECGKAFRQSSKLNEHKKVHTGERPYKC--DECGKAFGRSRVLNEHKKIHTGEKPYKC 457

  Fly   294 PLCPARFLRKSNHKQHLKVH 313
            ..|...|.|.::..||.|:|
Human   458 EECGKAFRRSTDRSQHKKIH 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 5/19 (26%)
zf-H2C2_2 113..138 CDD:290200 12/24 (50%)
C2H2 Zn finger 129..149 CDD:275368 6/19 (32%)
zf-H2C2_2 142..166 CDD:290200 11/23 (48%)
COG5048 151..>264 CDD:227381 37/127 (29%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 8/35 (23%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
ZNF141XP_016864080.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.