DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF140

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_011533135.1 Gene:ZNF140 / 7699 HGNCID:12925 Length:458 Species:Homo sapiens


Alignment Length:348 Identity:97/348 - (27%)
Similarity:141/348 - (40%) Gaps:80/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DLSGERLPMEMELLNPGSEYDLLELVNGALQQRNTTEH-KPTDMCKPKRTPTTK----RH---RT 94
            |.|.:.|.|| .:|:.|..|...:   |..:.::.||. :....|..|.|.:.:    :|   .|
Human    97 DDSSQYLIME-RILSQGPVYSSFK---GGWKCKDHTEMLQENQGCIRKVTVSHQEALAQHMNIST 157

  Fly    95 TGKDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDI 159
            ..:.:.|..|.:.|...::|.:|:.|||.|||:.|.||||.|.|::.|..|.:.||.::||:|..
Human   158 VERPYGCHECGKTFGRRFSLVLHQRTHTGEKPYACKECGKTFSQISNLVKHQMIHTGKKPHECKD 222

  Fly   160 CGKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSF------------------------------ 194
            |.|.|.|.::|..|:|.|||||||.|  |:|..:|                              
Human   223 CNKTFSYLSFLIEHQRTHTGEKPYEC--TECGKAFSRASNLTRHQRIHIGKKQYICRKCGKAFSS 285

  Fly   195 ------HSI-HA--------------RRIHTKLRH-AAQTDPDPE-----------HPLAEQEQR 226
                  |.| |.              ||.....|| :..|...|.           |....:.||
Human   286 GSELIRHQITHTGEKPYECIECGKAFRRFSHLTRHQSIHTTKTPYECNECRKAFRCHSFLIKHQR 350

  Fly   227 -DTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRP 290
             ......:.|..|.:|.|....|..|.|.|..::.:.|  .||.|.|..:..|..||..||.::|
Human   351 IHAGEKLYECDECGKVFTWHASLIQHTKSHTGEKPYAC--AECDKAFSRSFSLILHQRTHTGEKP 413

  Fly   291 FACPLCPARFLRKSNHKQHLKVH 313
            :.|.:|...|...||..:|.:.|
Human   414 YVCKVCNKSFSWSSNLAKHQRTH 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 5/19 (26%)
zf-H2C2_2 113..138 CDD:290200 14/24 (58%)
C2H2 Zn finger 129..149 CDD:275368 9/19 (47%)
zf-H2C2_2 142..166 CDD:290200 10/23 (43%)
COG5048 151..>264 CDD:227381 41/176 (23%)
C2H2 Zn finger 157..177 CDD:275368 8/19 (42%)
C2H2 Zn finger 185..206 CDD:275368 9/71 (13%)
C2H2 Zn finger 235..255 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
ZNF140XP_011533135.1 KRAB 6..66 CDD:214630
KRAB 6..45 CDD:279668
COG5048 160..>453 CDD:227381 81/281 (29%)
C2H2 Zn finger 164..184 CDD:275368 5/19 (26%)
zf-H2C2_2 176..201 CDD:290200 14/24 (58%)
C2H2 Zn finger 192..212 CDD:275368 9/19 (47%)
zf-H2C2_2 204..229 CDD:290200 10/24 (42%)
C2H2 Zn finger 220..240 CDD:275368 8/19 (42%)
zf-H2C2_2 233..257 CDD:290200 14/25 (56%)
C2H2 Zn finger 248..268 CDD:275368 4/21 (19%)
zf-H2C2_2 260..285 CDD:290200 0/24 (0%)
C2H2 Zn finger 276..296 CDD:275368 2/19 (11%)
zf-H2C2_2 288..313 CDD:290200 3/24 (13%)
C2H2 Zn finger 304..324 CDD:275368 4/19 (21%)
C2H2 Zn finger 332..352 CDD:275368 3/19 (16%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
zf-H2C2_2 372..397 CDD:290200 9/26 (35%)
C2H2 Zn finger 388..408 CDD:275368 8/21 (38%)
zf-H2C2_2 400..424 CDD:290200 8/23 (35%)
C2H2 Zn finger 416..436 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.