DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF90

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_009069.1 Gene:ZNF90 / 7643 HGNCID:13165 Length:601 Species:Homo sapiens


Alignment Length:257 Identity:85/257 - (33%)
Similarity:124/257 - (48%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HKPTDMCKPKRTPTT----KRHRTTGKDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKG 135
            :|..|..|..:..:|    ||..|..|.:.||.|.|.|..:..|.:||::||:|||:.|.||||.
Human   257 YKCEDCGKELKYSSTLTAHKRIHTGEKPYKCDKCGRAFISSSILYVHKISHTEEKPYKCEECGKA 321

  Fly   136 FRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSFHSIHAR 200
            |:..:.|..|...||.|:|:||:.|||.||.:..|..|:|:|||||||.|  ..|..:|.|....
Human   322 FKLSSILSTHKRIHTGEKPYKCEECGKAFRRSLVLRTHKRIHTGEKPYKC--DKCGKAFISSSLL 384

  Fly   201 RIHTKLRHAAQTDPDPE--------------HPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIH 251
            ..| |:.|:.:.....|              |.::..|::     .:.|..|.:|......||.|
Human   385 YKH-KISHSEKKPYKCEECGKAFKRSSTLTIHKISHTEEK-----PYKCQECDKVFKRSSALSTH 443

  Fly   252 LKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKVH 313
            ...|..::.:.|  .||||.|..:|.|..|:|:||:::.:.|..|...|...|....|..:|
Human   444 KIIHSGEKPYKC--EECGKAFKRSSNLTTHKISHTEEKLYKCQECDKAFKYSSALSTHKIIH 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 8/19 (42%)
zf-H2C2_2 113..138 CDD:290200 14/24 (58%)
C2H2 Zn finger 129..149 CDD:275368 8/19 (42%)
zf-H2C2_2 142..166 CDD:290200 12/23 (52%)
COG5048 151..>264 CDD:227381 36/126 (29%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 5/20 (25%)
C2H2 Zn finger 235..255 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..285 CDD:275368 10/21 (48%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)
ZNF90NP_009069.1 KRAB 4..62 CDD:214630
KRAB 6..43 CDD:279668
COG5048 170..501 CDD:227381 84/253 (33%)
C2H2 Zn finger 175..195 CDD:275368
C2H2 Zn finger 203..223 CDD:275368
C2H2 Zn finger 231..251 CDD:275368
C2H2 Zn finger 259..279 CDD:275368 5/19 (26%)
zf-H2C2_2 272..296 CDD:290200 9/23 (39%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
zf-H2C2_2 300..323 CDD:290200 13/22 (59%)
C2H2 Zn finger 315..335 CDD:275368 8/19 (42%)
zf-H2C2_2 328..352 CDD:290200 12/23 (52%)
C2H2 Zn finger 343..363 CDD:275368 9/19 (47%)
zf-H2C2_2 356..380 CDD:290200 13/25 (52%)
C2H2 Zn finger 371..391 CDD:275368 6/22 (27%)
C2H2 Zn finger 399..419 CDD:275368 2/19 (11%)
C2H2 Zn finger 427..447 CDD:275368 6/19 (32%)
zf-H2C2_2 439..464 CDD:290200 10/26 (38%)
C2H2 Zn finger 455..475 CDD:275368 10/21 (48%)
C2H2 Zn finger 483..503 CDD:275368 5/19 (26%)
zf-H2C2_2 495..520 CDD:290200 2/9 (22%)
C2H2 Zn finger 511..531 CDD:275368
zf-H2C2_2 524..548 CDD:290200
C2H2 Zn finger 539..559 CDD:275368
zf-H2C2_2 552..575 CDD:290200
C2H2 Zn finger 567..587 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.