DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF84

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001120844.1 Gene:ZNF84 / 7637 HGNCID:13159 Length:738 Species:Homo sapiens


Alignment Length:271 Identity:91/271 - (33%)
Similarity:133/271 - (49%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YDLLELVNGALQQRNTTEH---KPTDM--CKP---KRTPTTKRHRT-TG-KDHTCDICDRRFSEA 111
            ::..||:      |:.|.|   ||.:.  |:.   :|:......|| || |.|.|..|.:.||:.
Human   385 FEKSELI------RHQTIHTGEKPYECSECRKAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQK 443

  Fly   112 YNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRL 176
            .:|..|:||||.|||.:|.:|||.|.:.::|..|..|||.|:|::|..|||.|.....||.|:|:
Human   444 SHLISHQMTHTGEKPFICSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRI 508

  Fly   177 HTGEKPYPCLATDCHLSF----HSIHARRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPV 237
            |||||||.|  ::|..:|    |.|..:|.||           .|.|             :.|..
Human   509 HTGEKPYVC--SECGKAFCQKSHLISHQRTHT-----------GEKP-------------YECSE 547

  Fly   238 CSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLR 302
            |.:...::..|:.|.:.|..::.:.|  .:|.|.|...|:|..||..||.::|:.|.||...|..
Human   548 CGKAFGEKSSLATHQRTHTGEKPYEC--RDCEKAFSQKSQLNTHQRIHTGEKPYECSLCRKAFFE 610

  Fly   303 KSNHKQHLKVH 313
            ||...:||:.|
Human   611 KSELIRHLRTH 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 7/19 (37%)
zf-H2C2_2 113..138 CDD:290200 14/24 (58%)
C2H2 Zn finger 129..149 CDD:275368 7/19 (37%)
zf-H2C2_2 142..166 CDD:290200 12/23 (52%)
COG5048 151..>264 CDD:227381 33/116 (28%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 8/24 (33%)
C2H2 Zn finger 235..255 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
ZNF84NP_001120844.1 KRAB 9..68 CDD:214630
C2H2 Zn finger 209..229 CDD:275368
C2H2 Zn finger 237..257 CDD:275368
C2H2 Zn finger 265..285 CDD:275368
zf-H2C2_2 278..302 CDD:316026
C2H2 Zn finger 293..313 CDD:275368
COG5048 317..724 CDD:227381 91/271 (34%)
C2H2 Zn finger 321..341 CDD:275368
C2H2 Zn finger 349..369 CDD:275368
C2H2 Zn finger 377..397 CDD:275368 4/17 (24%)
C2H2 Zn finger 405..425 CDD:275368 3/19 (16%)
C2H2 Zn finger 433..453 CDD:275368 7/19 (37%)
C2H2 Zn finger 461..481 CDD:275368 7/19 (37%)
C2H2 Zn finger 489..509 CDD:275368 9/19 (47%)
C2H2 Zn finger 517..537 CDD:275368 6/21 (29%)
C2H2 Zn finger 545..565 CDD:275368 4/19 (21%)
C2H2 Zn finger 573..593 CDD:275368 8/21 (38%)
C2H2 Zn finger 601..621 CDD:275368 8/19 (42%)
C2H2 Zn finger 629..649 CDD:275368
C2H2 Zn finger 657..677 CDD:275368
C2H2 Zn finger 685..705 CDD:275368
C2H2 Zn finger 713..733 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.