DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF571

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_016882344.1 Gene:ZNF571 / 51276 HGNCID:25000 Length:651 Species:Homo sapiens


Alignment Length:262 Identity:83/262 - (31%)
Similarity:124/262 - (47%) Gaps:47/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LELVNGALQQRNTTEHKPTDMCKPKRTPTTKRHRTTGKDHTCDICDRRFSEAYNLRIHKMTHTDE 124
            :|..:...:.|||...||:.:       ..:|.:|..|.:.|..|.:.|....:|..|:..||:|
Human   205 IEKCSEVKKHRNTFSKKPSYI-------QHQRIQTGEKPYECMECGKAFGRTSDLIQHQKIHTNE 262

  Fly   125 KPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATD 189
            ||:.|..|||.|.:.::|..|...||.|:|::|..|||.|.|.:..|:|:|:|:|||||.|  .|
Human   263 KPYQCNACGKAFIRGSQLTEHQRVHTGEKPYECKKCGKAFSYCSQYTLHQRIHSGEKPYEC--KD 325

  Fly   190 C--------HLSFHSIHARRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQC 246
            |        .|::|    :|||:           .|.|             :.|..|.:......
Human   326 CGKAFILGSQLTYH----QRIHS-----------GEKP-------------YECKECGKAFILGS 362

  Fly   247 YLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLK 311
            :|:.|.:.|..::.:.|  .||||.|..||:|..||..||.::|:.|..|...|.|.|....||:
Human   363 HLTYHQRVHTGEKPYIC--KECGKAFLCASQLNEHQRIHTGEKPYECKECGKTFFRGSQLTYHLR 425

  Fly   312 VH 313
            ||
Human   426 VH 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 5/19 (26%)
zf-H2C2_2 113..138 CDD:290200 12/24 (50%)
C2H2 Zn finger 129..149 CDD:275368 7/19 (37%)
zf-H2C2_2 142..166 CDD:290200 11/23 (48%)
COG5048 151..>264 CDD:227381 32/120 (27%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 8/28 (29%)
C2H2 Zn finger 235..255 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..285 CDD:275368 11/21 (52%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
ZNF571XP_016882344.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.