DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF727

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001152994.1 Gene:ZNF727 / 442319 HGNCID:22785 Length:499 Species:Homo sapiens


Alignment Length:274 Identity:85/274 - (31%)
Similarity:120/274 - (43%) Gaps:49/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TEHKPT-------------DMCKPKRTPTTKRHRTTGKDHTCDICDRRFSEAYNLRIHKMTHTDE 124
            ||||..             ..|:.......||..|..:.:.|:.|.:...:..||..|...||.:
Human   161 TEHKKIFSREKCYKCEECGKDCRLSDFTIQKRIHTADRSYKCEECGKACKKFSNLTEHNRVHTGK 225

  Fly   125 KPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATD 189
            ||:.|.||||.|...:.|..|...||.:||:||:.|.|.||..:.||.|:|:|||||||.|  .:
Human   226 KPYKCEECGKTFTCSSALTKHKRNHTGDRPYKCEECHKAFRCCSDLTKHKRIHTGEKPYKC--KE 288

  Fly   190 CHLSFH-----SIHARRIHTKLRHAAQTDPDPEHP---------------LAEQEQRDTSALSFT 234
            ||.:|.     :.| :||||           .|.|               |::..:..|....:.
Human   289 CHKAFRCCSDLTKH-KRIHT-----------GEKPYKCNECGKAFMWISALSQHNRIHTGEKPYI 341

  Fly   235 CPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPAR 299
            |..|.:..|....|..|.:.|...|.:.|  .||||.|...|:|.:|:..||.::|:.|..|...
Human   342 CEECGKAFTYSSTLISHKRIHMELRPYKC--EECGKTFKWFSDLTNHKRIHTGEKPYKCEECGKS 404

  Fly   300 FLRKSNHKQHLKVH 313
            |...||..:|.::|
Human   405 FTCSSNLIKHKRIH 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 5/19 (26%)
zf-H2C2_2 113..138 CDD:290200 13/24 (54%)
C2H2 Zn finger 129..149 CDD:275368 8/19 (42%)
zf-H2C2_2 142..166 CDD:290200 11/23 (48%)
COG5048 151..>264 CDD:227381 39/132 (30%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 9/25 (36%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 9/21 (43%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
ZNF727NP_001152994.1 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 148..167 CDD:275370 4/5 (80%)
C2H2 Zn finger 175..194 CDD:275368 3/18 (17%)
C2H2 Zn finger 202..222 CDD:275368 5/19 (26%)
zf-H2C2_2 214..239 CDD:290200 13/24 (54%)
COG5048 <226..409 CDD:227381 66/198 (33%)
C2H2 Zn finger 230..250 CDD:275368 8/19 (42%)
zf-H2C2_2 242..267 CDD:290200 11/24 (46%)
C2H2 Zn finger 258..278 CDD:275368 9/19 (47%)
zf-H2C2_2 270..295 CDD:290200 15/26 (58%)
C2H2 Zn finger 286..306 CDD:275368 6/22 (27%)
zf-H2C2_2 298..321 CDD:290200 7/34 (21%)
C2H2 Zn finger 314..334 CDD:275368 1/19 (5%)
zf-H2C2_2 326..351 CDD:290200 4/24 (17%)
C2H2 Zn finger 342..362 CDD:275368 5/19 (26%)
C2H2 Zn finger 370..390 CDD:275368 9/21 (43%)
zf-H2C2_2 382..407 CDD:290200 8/24 (33%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368
zf-H2C2_2 438..463 CDD:290200
C2H2 Zn finger 454..474 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.