DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF506

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001092739.1 Gene:ZNF506 / 440515 HGNCID:23780 Length:444 Species:Homo sapiens


Alignment Length:233 Identity:80/233 - (34%)
Similarity:113/233 - (48%) Gaps:34/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TTKRHRTTGKDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAE 152
            |.|:..|..|.:.|:.|.:.:.::.||..||:.||.|||:.|.||||.|.....|..|...||.|
Human   218 THKKIHTGEKPYKCEECGKAYKQSCNLTTHKIIHTGEKPYRCRECGKAFNHPATLFSHKKIHTGE 282

  Fly   153 RPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSFH-----SIHARRIHTKLRHAAQT 212
            :|:|||.|||.|..::.||.|..:|||||||.|  .:|..:|:     :.| :|||         
Human   283 KPYKCDKCGKAFISSSTLTKHEIIHTGEKPYKC--EECGKAFNRSSNLTKH-KRIH--------- 335

  Fly   213 DPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASE 277
                           |..:.:.|..|.:..|....||.|.:.|..::.:.|  .||||.|.:.|.
Human   336 ---------------TGDVPYKCDECGKTFTWYSSLSKHKRAHTGEKPYKC--EECGKAFTAFST 383

  Fly   278 LKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKVHER 315
            |..|:|.||.::|:.|..|...|...|...:|.|:|.|
Human   384 LTEHKIIHTGEKPYKCEECGKAFNWSSALNKHKKIHIR 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 6/19 (32%)
zf-H2C2_2 113..138 CDD:290200 15/24 (63%)
C2H2 Zn finger 129..149 CDD:275368 8/19 (42%)
zf-H2C2_2 142..166 CDD:290200 13/23 (57%)
COG5048 151..>264 CDD:227381 34/117 (29%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 7/25 (28%)
C2H2 Zn finger 235..255 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..285 CDD:275368 10/21 (48%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
ZNF506NP_001092739.1 KRAB 4..62 CDD:214630
KRAB 6..43 CDD:279668
C2H2 Zn finger 147..167 CDD:275368
C2H2 Zn finger 175..195 CDD:275368
C2H2 Zn finger 203..223 CDD:275368 2/4 (50%)
zf-H2C2_2 215..240 CDD:290200 6/21 (29%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
zf-H2C2_2 243..268 CDD:290200 15/24 (63%)
COG5048 <255..417 CDD:227381 64/190 (34%)
C2H2 Zn finger 259..279 CDD:275368 8/19 (42%)
zf-H2C2_2 272..296 CDD:290200 13/23 (57%)
C2H2 Zn finger 287..307 CDD:275368 9/19 (47%)
zf-H2C2_2 300..324 CDD:290200 13/25 (52%)
C2H2 Zn finger 315..335 CDD:275368 5/22 (23%)
zf-H2C2_2 327..351 CDD:290200 7/48 (15%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
zf-H2C2_2 355..379 CDD:290200 9/25 (36%)
C2H2 Zn finger 371..391 CDD:275368 10/21 (48%)
zf-H2C2_2 384..407 CDD:290200 8/22 (36%)
C2H2 Zn finger 399..419 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.