DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF879

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001129588.1 Gene:ZNF879 / 345462 HGNCID:37273 Length:563 Species:Homo sapiens


Alignment Length:327 Identity:92/327 - (28%)
Similarity:141/327 - (43%) Gaps:65/327 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CLEDLQLFAQLEDL-------SGERLPMEMELLNPGSEYDLLELVNGALQQRNTTEHKPTDMCKP 83
            |.|..:.|:|...|       :||:..:..|.   |..:.....:.|  .||..|..:|. .||.
Human   234 CKECRKAFSQSSSLTQHLRVHTGEKPYICSEC---GKAFSFTTSLIG--HQRMHTGERPY-KCKE 292

  Fly    84 -----KRTPTTKRHR---TTGKDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLN 140
                 |.:.:...|:   |..|.:.|:.|.|.||:..:|..|...||.|||:.|.:|||.|..::
Human   293 CGKTFKGSSSLNNHQRIHTGEKPYKCNECGRAFSQCSSLIQHHRIHTGEKPYECTQCGKAFTSIS 357

  Fly   141 KLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSFHS----IHARR 201
            :|..|...||.|:|..|:.|||.|.|.:.|.:|:|:|||||||.|  .:|..:|..    |..:|
Human   358 RLSRHHRIHTGEKPFHCNECGKVFSYHSALIIHQRIHTGEKPYAC--KECGKAFSQSSALIQHQR 420

  Fly   202 IHT--------------------KLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQC 246
            |||                    .:.|...|...|                :.|..|.:..:...
Human   421 IHTGEKPYKCNECGKAFSWISRLNIHHRIHTGEKP----------------YNCKECGKAFSSHS 469

  Fly   247 YLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLK 311
            .::.|.|.|..::.:.|  .:|.|.|..:|.|..||..||.::|:.|.:|...|.:.|:...|::
Human   470 GVNTHRKIHTGEKPYKC--NDCEKAFNQSSALIQHQRIHTGEKPYNCKVCGKAFRQSSSLMTHMR 532

  Fly   312 VH 313
            :|
Human   533 IH 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 7/19 (37%)
zf-H2C2_2 113..138 CDD:290200 12/24 (50%)
C2H2 Zn finger 129..149 CDD:275368 7/19 (37%)
zf-H2C2_2 142..166 CDD:290200 11/23 (48%)
COG5048 151..>264 CDD:227381 34/136 (25%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 8/44 (18%)
C2H2 Zn finger 235..255 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)
ZNF879NP_001129588.1 KRAB 14..74 CDD:214630
COG5048 202..558 CDD:227381 92/327 (28%)
C2H2 Zn finger 206..226 CDD:275368
C2H2 Zn finger 234..254 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 5/24 (21%)
C2H2 Zn finger 290..310 CDD:275368 4/19 (21%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..366 CDD:275368 7/19 (37%)
C2H2 Zn finger 374..394 CDD:275368 9/19 (47%)
C2H2 Zn finger 402..422 CDD:275368 5/21 (24%)
C2H2 Zn finger 430..450 CDD:275368 1/19 (5%)
C2H2 Zn finger 458..478 CDD:275368 4/19 (21%)
C2H2 Zn finger 486..506 CDD:275368 8/21 (38%)
C2H2 Zn finger 514..534 CDD:275368 5/19 (26%)
C2H2 Zn finger 542..562 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.