DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF283

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_862828.1 Gene:ZNF283 / 284349 HGNCID:13077 Length:679 Species:Homo sapiens


Alignment Length:264 Identity:86/264 - (32%)
Similarity:125/264 - (47%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QRNTTEHKPTDMCKP---------KRTPTTKRHRTTG-KDHTCDICDRRFSEAYNLRIHKMTHTD 123
            :|..|..||.: ||.         ..|...|.|  || |.:.|..|.:.|....:|..|::.||.
Human   282 ERIHTGEKPYE-CKECGKAFSRGYHLTQHQKIH--TGVKSYKCKECGKAFFWGSSLAKHEIIHTG 343

  Fly   124 EKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLAT 188
            |||:.|.||||.|.:..:|..|...||.::|::|.||||.|.:...||.|:..|||||||.|  .
Human   344 EKPYKCKECGKAFSRGYQLTQHQKIHTGKKPYECKICGKAFCWGYQLTRHQIFHTGEKPYEC--K 406

  Fly   189 DCHLSFHS----IHARRIHT-----KLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTD 244
            :|..:|:.    |...||||     :.:...:......| |::.::..|....|.|..|.:..:.
Human   407 ECGKAFNCGSSLIQHERIHTGEKPYECKECGKAFSRGYH-LSQHQKIHTGEKPFECKECGKAFSW 470

  Fly   245 QCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQH 309
            ...|..|.:.|..::...|  .||||.|.|..:|..||:.||.::|:.|..|...|...|:..||
Human   471 GSSLVKHERVHTGEKSHEC--KECGKTFCSGYQLTRHQVFHTGEKPYECKECGKAFNCGSSLVQH 533

  Fly   310 LKVH 313
            .::|
Human   534 ERIH 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 5/19 (26%)
zf-H2C2_2 113..138 CDD:290200 13/24 (54%)
C2H2 Zn finger 129..149 CDD:275368 8/19 (42%)
zf-H2C2_2 142..166 CDD:290200 11/23 (48%)
COG5048 151..>264 CDD:227381 34/121 (28%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 8/29 (28%)
C2H2 Zn finger 235..255 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..285 CDD:275368 10/21 (48%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
ZNF283NP_862828.1 KRAB 72..113 CDD:307490
C2H2 Zn finger 209..229 CDD:275368
C2H2 Zn finger 237..257 CDD:275368
COG5048 261..655 CDD:227381 86/264 (33%)
C2H2 Zn finger 265..285 CDD:275368 1/2 (50%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
C2H2 Zn finger 321..341 CDD:275368 5/19 (26%)
C2H2 Zn finger 349..369 CDD:275368 8/19 (42%)
C2H2 Zn finger 377..397 CDD:275368 9/19 (47%)
C2H2 Zn finger 405..425 CDD:275368 5/21 (24%)
C2H2 Zn finger 433..453 CDD:275368 2/20 (10%)
C2H2 Zn finger 461..481 CDD:275368 4/19 (21%)
C2H2 Zn finger 489..509 CDD:275368 10/21 (48%)
C2H2 Zn finger 517..537 CDD:275368 6/19 (32%)
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 573..593 CDD:275368
C2H2 Zn finger 601..621 CDD:275368
C2H2 Zn finger 629..648 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.