DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and Zfp46

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001357580.1 Gene:Zfp46 / 22704 MGIID:99192 Length:470 Species:Mus musculus


Alignment Length:350 Identity:108/350 - (30%)
Similarity:162/350 - (46%) Gaps:60/350 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RSIDPVSQMANATLADDDLGNYDVCLEDLQLFAQLE--------------DLSGERLPMEMELLN 52
            |.:||..:.....:..::.||  |...|.::.::.|              .:|.|  |:|....|
Mouse    29 RPLDPTQRDLYRDVMQENYGN--VVSLDFEIRSENEANPKQEFSDDVEFATMSEE--PLENAEKN 89

  Fly    53 PGSEY-------------DLL--ELVNGALQQRNTTEHKPTDMCKPKRTPTTKRHRTTGKDHTCD 102
            ||||.             ||.  |.|:..|||       .||:...|......|:      |.|.
Mouse    90 PGSEEAFESGDQAERPWGDLTAEEWVSYPLQQ-------VTDLLVHKEAHAGIRY------HICS 141

  Fly   103 ICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYA 167
            .|.:.||:..:|..|:.|||.::|:.|.||||||.:.:.|..|..|||.|||:.|:.|||.|..:
Mouse   142 QCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCNECGKSFGRS 206

  Fly   168 NYLTVHRRLHTGEKPYPCLATDCHLSF----HSIHARRIHT-----KLRHAAQTDPDPEHPLAEQ 223
            ::|..|:.:||||||:.|  |:|..||    |.|..:|.|:     :.....::.....| ||:.
Mouse   207 SHLIQHQTIHTGEKPHKC--TECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSH-LAQH 268

  Fly   224 EQRDTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQ 288
            ::..|....:.|..|.|..:::..|..|.:.|..:|.:.|  .||||.|...|:|..|:.|||.:
Mouse   269 QRTHTGEKPYECHECGRGFSERSDLIKHYRVHTGERPYKC--DECGKNFSQNSDLVRHRRAHTGE 331

  Fly   289 RPFACPLCPARFLRKSNHKQHLKVH 313
            :|:.|..|...|.|.|:..||.:.|
Mouse   332 KPYHCNECGENFSRISHLVQHQRTH 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 6/19 (32%)
zf-H2C2_2 113..138 CDD:290200 13/24 (54%)
C2H2 Zn finger 129..149 CDD:275368 9/19 (47%)
zf-H2C2_2 142..166 CDD:290200 13/23 (57%)
COG5048 151..>264 CDD:227381 36/121 (30%)
C2H2 Zn finger 157..177 CDD:275368 7/19 (37%)
C2H2 Zn finger 185..206 CDD:275368 9/29 (31%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 9/21 (43%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
Zfp46NP_001357580.1 KRAB 13..54 CDD:366587 6/26 (23%)
C2H2 Zn finger 140..160 CDD:275368 6/19 (32%)
COG5048 163..>470 CDD:227381 69/198 (35%)
C2H2 Zn finger 168..188 CDD:275368 9/19 (47%)
C2H2 Zn finger 196..216 CDD:275368 7/19 (37%)
C2H2 Zn finger 224..244 CDD:275368 8/21 (38%)
C2H2 Zn finger 252..272 CDD:275368 3/20 (15%)
C2H2 Zn finger 280..300 CDD:275368 5/19 (26%)
C2H2 Zn finger 308..328 CDD:275368 9/21 (43%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
C2H2 Zn finger 364..384 CDD:275368
C2H2 Zn finger 392..412 CDD:275368
C2H2 Zn finger 420..440 CDD:275368
C2H2 Zn finger 448..468 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.