DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF540

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001165696.1 Gene:ZNF540 / 163255 HGNCID:25331 Length:660 Species:Homo sapiens


Alignment Length:325 Identity:97/325 - (29%)
Similarity:141/325 - (43%) Gaps:68/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SGERLPMEMELLNPGSEYDLLELVNGALQQRNTTEHKPTDMCKP------KRTPTT--KRHRTTG 96
            :||: |.|.:  ..|..:.|...:|  ..|:..|..||. |||.      .|...|  ||..|..
Human   238 TGEK-PYECQ--ECGKTFTLYPQLN--RHQKIHTGKKPY-MCKKCDKGFFSRLELTQHKRIHTGK 296

  Fly    97 KDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICG 161
            |.:.|..|.:.|...:..:.|:..||.:||:.|.||||.|....:|..|...||..:|::|..||
Human   297 KSYECKECGKVFQLIFYFKEHERIHTGKKPYECKECGKAFSVCGQLTRHQKIHTGVKPYECKECG 361

  Fly   162 KGFRYANYLTVHRRLHTGEKPYPCLATDCHLSFH---------SIHA------------------ 199
            |.||.:.|||.|||.|.|:|||.|  .:|..||:         :||.                  
Human   362 KTFRLSFYLTEHRRTHAGKKPYEC--KECGKSFNVRGQLNRHKTIHTGIKPFACKVCEKAFSYSG 424

  Fly   200 -RRIHTKLRHAAQTDPDPEHP---------------LAEQEQRDTSALSFTCPVCSRVLTDQCYL 248
             .|:|::: |..      |.|               |.|.::..|....:.|..|.:....:..:
Human   425 DLRVHSRI-HTG------EKPYECKECGKAFMLRSVLTEHQRLHTGVKPYECKECGKTFRVRSQI 482

  Fly   249 SIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKVH 313
            |:|.|.|.:.:.:.|.:  |||.|.....|..||..||.::|:.|..|...|:|:.|.|:|||:|
Human   483 SLHKKIHTDVKPYKCVR--CGKTFRFGFYLTEHQRIHTGEKPYKCKECGKAFIRRGNLKEHLKIH 545

  Fly   314  313
            Human   546  545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 4/19 (21%)
zf-H2C2_2 113..138 CDD:290200 11/24 (46%)
C2H2 Zn finger 129..149 CDD:275368 8/19 (42%)
zf-H2C2_2 142..166 CDD:290200 10/23 (43%)
COG5048 151..>264 CDD:227381 38/155 (25%)
C2H2 Zn finger 157..177 CDD:275368 12/19 (63%)
C2H2 Zn finger 185..206 CDD:275368 8/48 (17%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 9/19 (47%)
ZNF540NP_001165696.1 KRAB 6..66 CDD:214630
C2H2 Zn finger 189..209 CDD:275368
C2H2 Zn finger 217..237 CDD:275368
COG5048 241..620 CDD:227381 95/322 (30%)
C2H2 Zn finger 245..265 CDD:275368 4/23 (17%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
C2H2 Zn finger 301..321 CDD:275368 4/19 (21%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
C2H2 Zn finger 357..377 CDD:275368 12/19 (63%)
C2H2 Zn finger 385..405 CDD:275368 4/21 (19%)
C2H2 Zn finger 413..433 CDD:275368 2/20 (10%)
C2H2 Zn finger 441..461 CDD:275368 2/19 (11%)
C2H2 Zn finger 469..489 CDD:275368 5/19 (26%)
C2H2 Zn finger 497..517 CDD:275368 8/21 (38%)
C2H2 Zn finger 525..545 CDD:275368 9/19 (47%)
C2H2 Zn finger 553..573 CDD:275368
C2H2 Zn finger 581..601 CDD:275368
C2H2 Zn finger 609..629 CDD:275368
zf-H2C2_2 621..646 CDD:316026
C2H2 Zn finger 637..657 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.