DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF813

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001004301.2 Gene:ZNF813 / 126017 HGNCID:33257 Length:617 Species:Homo sapiens


Alignment Length:280 Identity:93/280 - (33%)
Similarity:122/280 - (43%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QQRNTTEHKPTDMC----KPKR------------TPTTKRHRTTG-KDHTCDICDRRFSEAYNLR 115
            ::||...|:   .|    ||.|            :.|..|...|| |.:.|:.||:.||...||:
Human   254 RKRNLVCHR---RCHTGEKPYRCNECGKTFSQTYSLTCHRRLHTGEKPYKCEECDKAFSFKSNLK 315

  Fly   116 IHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGE 180
            .|:..|..|||:.|.||||.|.|.:.|..|...||.|:|.||:.|||.|...:.||.|.||||||
Human   316 RHRRIHAGEKPYKCNECGKTFSQTSSLTCHRRLHTGEKPFKCNECGKTFSRKSSLTCHHRLHTGE 380

  Fly   181 KPYPC----------LATDCHLSFHSIHARRIHT-----KLRHAAQTDPDPEHPLAEQEQRDTSA 230
            |||.|          |...||        ||:||     |.....:.. :.:..||...:..:..
Human   381 KPYKCNECGKTFSQELTLKCH--------RRLHTGEKPYKCNECGKVF-NKKANLARHHRLHSGE 436

  Fly   231 LSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPL 295
            ..:.|..|.:..:....|.||...|..::.:.|  .||||.|...|.|..|...||.::|:.|..
Human   437 KPYKCTECVKTFSRNSALVIHKAIHIGEKRYKC--NECGKTFSRISALVIHTAIHTGEKPYKCNE 499

  Fly   296 CPARFLRKSNHKQHLKVHER 315
            |...|    |.|.||..|.|
Human   500 CGKGF----NRKTHLACHHR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 8/19 (42%)
zf-H2C2_2 113..138 CDD:290200 13/24 (54%)
C2H2 Zn finger 129..149 CDD:275368 9/19 (47%)
zf-H2C2_2 142..166 CDD:290200 12/23 (52%)
COG5048 151..>264 CDD:227381 37/127 (29%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 8/35 (23%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 9/21 (43%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
ZNF813NP_001004301.2 KRAB 8..>48 CDD:214630
KRAB 8..47 CDD:279668
COG5048 191..602 CDD:227381 93/280 (33%)
C2H2 Zn finger 217..237 CDD:275368
zf-H2C2_2 230..254 CDD:290200 93/280 (33%)
C2H2 Zn finger 245..265 CDD:275368 3/13 (23%)
zf-H2C2_2 257..282 CDD:290200 6/27 (22%)
C2H2 Zn finger 273..293 CDD:275368 2/19 (11%)
zf-H2C2_2 285..309 CDD:290200 8/23 (35%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 13/24 (54%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
zf-H2C2_2 341..366 CDD:290200 12/24 (50%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 13/24 (54%)
C2H2 Zn finger 385..405 CDD:275368 6/27 (22%)
zf-H2C2_2 398..421 CDD:290200 7/31 (23%)
C2H2 Zn finger 413..433 CDD:275368 2/20 (10%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
C2H2 Zn finger 469..489 CDD:275368 9/21 (43%)
C2H2 Zn finger 497..517 CDD:275368 9/23 (39%)
zf-H2C2_2 509..534 CDD:290200 4/7 (57%)
C2H2 Zn finger 525..545 CDD:275368
C2H2 Zn finger 553..573 CDD:275368
zf-H2C2_2 565..590 CDD:290200
C2H2 Zn finger 581..601 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.