DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF257

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_258429.2 Gene:ZNF257 / 113835 HGNCID:13498 Length:563 Species:Homo sapiens


Alignment Length:263 Identity:83/263 - (31%)
Similarity:121/263 - (46%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RNTTEHKPTDMCKPKRTPTT----------KRHRTTGKDHTCDICDRRFSEAYNLRIHKMTHTDE 124
            |:...|.....||.|....:          ||.......|.|:.|.:.|:::..|..||||||.|
Human   162 RHKIRHTEKKTCKCKECGKSFCMLSQLTRHKRIHIRENSHKCEECGKAFNQSSALTRHKMTHTGE 226

  Fly   125 KPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATD 189
            ||:.|.||||.|.:.:.|..|.|.||.|:|:||:.|||.|..::::|.|:|:|..|||:.  ..:
Human   227 KPYKCEECGKAFNRSSHLTQHKVIHTREKPYKCEECGKAFNRSSHITQHKRIHNREKPFK--YDE 289

  Fly   190 CHLSFHSIHA-------RRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCY 247
            |..:|....|       :||||           .|.|             :.|..|.:.......
Human   290 CCKAFKWSSALTTLTQHKRIHT-----------GEKP-------------YKCEECGKAFNQSSA 330

  Fly   248 LSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKV 312
            |:.|...|..::.|.|  .||||.|..:|.|..|:|.||:::|:.|..|...|.|.|:..:|.::
Human   331 LTRHKMIHTGEKPFQC--EECGKAFNRSSHLTQHKIIHTKEKPYKCEECGKAFNRSSHLTKHKRI 393

  Fly   313 HER 315
            |.|
Human   394 HTR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 7/19 (37%)
zf-H2C2_2 113..138 CDD:290200 16/24 (67%)
C2H2 Zn finger 129..149 CDD:275368 9/19 (47%)
zf-H2C2_2 142..166 CDD:290200 13/23 (57%)
COG5048 151..>264 CDD:227381 30/119 (25%)
C2H2 Zn finger 157..177 CDD:275368 8/19 (42%)
C2H2 Zn finger 185..206 CDD:275368 7/27 (26%)
C2H2 Zn finger 235..255 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..285 CDD:275368 10/21 (48%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
ZNF257NP_258429.2 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
COG5048 <157..474 CDD:227381 83/263 (32%)
C2H2 Zn finger 175..195 CDD:275368 3/19 (16%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
zf-H2C2_2 215..240 CDD:290200 16/24 (67%)
C2H2 Zn finger 231..251 CDD:275368 9/19 (47%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 8/19 (42%)
C2H2 Zn finger 288..310 CDD:275368 4/21 (19%)
zf-H2C2_2 303..327 CDD:290200 8/47 (17%)
C2H2 Zn finger 318..338 CDD:275368 4/19 (21%)
zf-H2C2_2 330..355 CDD:290200 10/26 (38%)
C2H2 Zn finger 346..366 CDD:275368 10/21 (48%)
zf-H2C2_2 358..383 CDD:290200 9/24 (38%)
C2H2 Zn finger 374..394 CDD:275368 6/19 (32%)
zf-H2C2_2 418..442 CDD:290200
C2H2 Zn finger 433..453 CDD:275368
zf-H2C2_2 445..470 CDD:290200
C2H2 Zn finger 461..481 CDD:275368
zf-H2C2_2 473..498 CDD:290200
C2H2 Zn finger 489..509 CDD:275368
zf-H2C2_2 501..526 CDD:290200
C2H2 Zn finger 517..537 CDD:275368
C2H2 Zn finger 545..561 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.