DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2120 and ZNF737

DIOPT Version :9

Sequence 1:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_005259754.1 Gene:ZNF737 / 100129842 HGNCID:32468 Length:551 Species:Homo sapiens


Alignment Length:217 Identity:74/217 - (34%)
Similarity:112/217 - (51%) Gaps:24/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KDHTCDICDRRFSEAYNLRIHKMTHTDEKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICG 161
            |.:.|:.|.:.|..:.||..||:.||.|||:.|.||||.|::.:.|..|.:.|:.|:|:||:.||
Human   255 KPYKCEECGKAFKRSSNLTTHKIIHTGEKPYKCEECGKAFKRSSILTAHKIIHSGEKPYKCEECG 319

  Fly   162 KGFRYANYLTVHRRLHTGEKPYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHPLAEQEQR 226
            |.|::.:.||.|:|:|||||||.|  .:|..:|....:...| |:.|:.      |.|       
Human   320 KAFKHPSVLTTHKRIHTGEKPYKC--EECGRAFKYFSSLTTH-KIIHSG------EKP------- 368

  Fly   227 DTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPF 291
                  :.|..|.:......:|:.|.:.|..::.:.|  .|||:.|..:|.|..|:|.||.|:||
Human   369 ------YKCEECGKAFNWSSHLTTHKRIHTGEKPYKC--EECGEAFKYSSSLTTHKIIHTGQQPF 425

  Fly   292 ACPLCPARFLRKSNHKQHLKVH 313
            .|..|...|...|....|.::|
Human   426 KCEECGKAFKCFSILTTHKRIH 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 7/19 (37%)
zf-H2C2_2 113..138 CDD:290200 15/24 (63%)
C2H2 Zn finger 129..149 CDD:275368 8/19 (42%)
zf-H2C2_2 142..166 CDD:290200 11/23 (48%)
COG5048 151..>264 CDD:227381 32/112 (29%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 4/20 (20%)
C2H2 Zn finger 235..255 CDD:275368 4/19 (21%)
C2H2 Zn finger 263..285 CDD:275368 9/21 (43%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)
ZNF737XP_005259754.1 KRAB 4..62 CDD:214630
KRAB 6..43 CDD:279668
COG5048 143..528 CDD:227381 74/217 (34%)
zf-H2C2_2 159..184 CDD:290200
C2H2 Zn finger 175..195 CDD:275368
zf-H2C2_2 188..211 CDD:290200
C2H2 Zn finger 203..223 CDD:275368
zf-H2C2_2 215..240 CDD:290200
C2H2 Zn finger 231..251 CDD:275368
zf-H2C2_2 243..268 CDD:290200 4/12 (33%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
zf-H2C2_2 271..296 CDD:290200 15/24 (63%)
C2H2 Zn finger 287..307 CDD:275368 8/19 (42%)
zf-H2C2_2 300..324 CDD:290200 11/23 (48%)
C2H2 Zn finger 315..335 CDD:275368 9/19 (47%)
zf-H2C2_2 328..352 CDD:290200 14/25 (56%)
C2H2 Zn finger 343..363 CDD:275368 5/22 (23%)
zf-H2C2_2 355..379 CDD:290200 7/43 (16%)
C2H2 Zn finger 371..391 CDD:275368 4/19 (21%)
zf-H2C2_2 383..408 CDD:290200 8/26 (31%)
C2H2 Zn finger 399..419 CDD:275368 9/21 (43%)
C2H2 Zn finger 427..447 CDD:275368 5/19 (26%)
zf-H2C2_2 440..464 CDD:290200 2/8 (25%)
C2H2 Zn finger 455..475 CDD:275368
zf-H2C2_2 467..492 CDD:290200
C2H2 Zn finger 483..503 CDD:275368
zf-H2C2_2 496..520 CDD:290200
C2H2 Zn finger 511..529 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.