DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZNF282

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:XP_006716214.1 Gene:ZNF282 / 8427 HGNCID:13076 Length:672 Species:Homo sapiens


Alignment Length:410 Identity:93/410 - (22%)
Similarity:147/410 - (35%) Gaps:118/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EEDIIIVNENGVEKEMLMSKEL--------RDFIVGSRVKDLTDDEQMPQFVVRELDMSEVGDLV 109
            |:.:.:..:.|:|:..:.::.:        :|.:  ||:|     ::..|.|..:.|:::..  :
Human   295 EDTLCVRGQRGLEERAIPTESITVDSPISAQDLL--SRIK-----QEEHQCVWDQQDLADRD--I 350

  Fly   110 EVEPEMEQEADYGDYGDY---EHEPSYGHPRDNERVEEDLDMYPPSS-------PSLPPSP---P 161
            ..:|..|......|...:   |.:|....|||:...|..||..|..|       |..||.|   |
Human   351 PTDPNSESLISAHDILSWIKQEEQPYPWGPRDSMDGELGLDSGPSDSLLMVKNPPPAPPQPQPQP 415

  Fly   162 RPPSPVVQ---------PASKARNSARQIALRSFVSQKNNDDDDGSVKEVKPSEKMLEEFK---- 213
            :||.|.:|         |.:.|.|.....: |..:       |||.  :|.|.|:...|..    
Human   416 QPPQPQLQSQPQPQSLPPIAVAENPGGPPS-RGLL-------DDGF--QVLPGERGSGEAPPGGD 470

  Fly   214 ---------------------------------GPRRYMLFDDLIATIVDFDEDSTPLVEFSMIS 245
                                             |.||.:|....                     
Human   471 RSTGGGGGDGGGGGGGAEAGTGAGGGCGSCCPGGLRRSLLLHGA--------------------- 514

  Fly   246 DIMDEKLPVECGICPDVMH-KSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIR 309
                ...|..|..|..... :..|..||::|  .....|.|..|.:::.....|..|...|.|.|
Human   515 ----RSKPYSCPECGKSFGVRKSLIIHHRSH--TKERPYECAECEKSFNCHSGLIRHQMTHRGER 573

  Fly   310 PYVCELCTLYFSTKQDLRVHNQRRHL-EKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYC 373
            ||.|..|...:|.|:.|:.| ||.|. |:...|.:|||:|.:...|.:| :..|..:|.:.|..|
Human   574 PYKCSECEKTYSRKEHLQNH-QRLHTGERPFQCALCGKSFIRKQNLLKH-QRIHTGERPYTCGEC 636

  Fly   374 QKAYYKNFSLQEHIRNVHMG 393
            .|::....||::|:| ||.|
Human   637 GKSFRYKESLKDHLR-VHSG 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/19 (26%)
C2H2 Zn finger 285..305 CDD:275368 4/19 (21%)
PHA00733 <308..357 CDD:177301 19/49 (39%)
C2H2 Zn finger 313..334 CDD:275368 8/20 (40%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370
C2H2 Zn finger 429..447 CDD:275368
ZNF282XP_006716214.1 KRAB 198..260 CDD:214630
KRAB_A-box 198..237 CDD:143639
COG5048 <507..652 CDD:227381 45/174 (26%)
zf-C2H2 519..541 CDD:278523 5/21 (24%)
C2H2 Zn finger 521..541 CDD:275368 5/19 (26%)
zf-H2C2_2 533..558 CDD:290200 7/26 (27%)
C2H2 Zn finger 549..569 CDD:275368 4/19 (21%)
zf-H2C2_2 562..586 CDD:290200 9/23 (39%)
zf-C2H2 575..597 CDD:278523 9/22 (41%)
C2H2 Zn finger 577..597 CDD:275368 8/20 (40%)
zf-H2C2_2 589..614 CDD:290200 11/25 (44%)
C2H2 Zn finger 605..625 CDD:275368 7/20 (35%)
zf-H2C2_2 617..642 CDD:290200 7/25 (28%)
C2H2 Zn finger 633..653 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4954
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.