DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and YY1

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_849323.1 Gene:YY1 / 826093 AraportID:AT4G06634 Length:387 Species:Arabidopsis thaliana


Alignment Length:310 Identity:76/310 - (24%)
Similarity:108/310 - (34%) Gaps:66/310 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 SKLSKHHKTHLVPGTNRYACIY--CTETYRDCKYLAGHARRHMGIRPYVC--ELCTLYFSTKQDL 326
            |.|.||...|   |..:|.|..  |.:.:.|...|..|...|.|.|.|:|  |.|...||...:|
plant    94 SALRKHSHIH---GERQYVCDQEGCGKKFLDSSKLKRHYLIHTGERNYICTYEGCGKAFSLDFNL 155

  Fly   327 RVHNQRRHLEKEHICEV--CGKTFAQNTQLKRHREATHEKK------------------------ 365
            |.|.:....|..|||..  |.|.:|...:||.|..|.|||.                        
plant   156 RSHMKTHSQENYHICPYSGCVKRYAHEYKLKNHVAAYHEKNGGGETPKYTPPAEKVLRTVKTPAT 220

  Fly   366 -------RRFQCEY--CQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARH----R 417
                   |.:.|.|  |:|||...:.|:.|::..|.|..:        .:..|...:.:|    |
plant   221 VCGPSSDRPYACPYEGCEKAYIHEYKLKLHLKREHPGHLQ--------EENADTPTLNKHNGNDR 277

  Fly   418 KEMH--LSQGTYVCHLCQEEFTDISYFDAHKRSIQCRSNTRRFVNADGNREGSDSESISGRNMNG 480
            .|:.  ..|..|..|....:      ...||:..:.:.|.|. ..|...::||.|.....|....
plant   278 NEIDDGSDQDVYRKHASNGK------GQTHKQQSRAKPNMRT-PPAKVGKKGSTSSPAKARIAKK 335

  Fly   481 QDDDYDGMGPLQEEYDEDDGLLVEDNQPEEQG---SPSNRQYLDESEQQY 527
            .....:....::.|.:||.....||....|.|   ..:|....|:.|.:|
plant   336 PWQAKETFEEVEREEEEDSEETEEDRDNVEDGWRFGENNEDDDDDEETEY 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 4/8 (50%)
C2H2 Zn finger 285..305 CDD:275368 5/21 (24%)
PHA00733 <308..357 CDD:177301 19/52 (37%)
C2H2 Zn finger 313..334 CDD:275368 8/22 (36%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
C2H2 Zn finger 370..388 CDD:275368 8/19 (42%)
C2H2 Zn finger 400..418 CDD:275370 2/21 (10%)
C2H2 Zn finger 429..447 CDD:275368 2/17 (12%)
YY1NP_849323.1 C2H2 Zn finger 84..103 CDD:275368 4/8 (50%)
COG5048 <92..170 CDD:227381 26/78 (33%)
C2H2 Zn finger 110..132 CDD:275368 5/21 (24%)
C2H2 Zn finger 140..162 CDD:275368 8/21 (38%)
C2H2 Zn finger 170..189 CDD:275368 6/18 (33%)
SFP1 <196..274 CDD:227516 13/85 (15%)
C2H2 Zn finger 232..252 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.