DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZKSCAN3

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_001229823.1 Gene:ZKSCAN3 / 80317 HGNCID:13853 Length:538 Species:Homo sapiens


Alignment Length:304 Identity:86/304 - (28%)
Similarity:125/304 - (41%) Gaps:44/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 KARNSARQIALRSFVSQKNNDDDDGSVKEVKPSEKMLEEFKGPRRYMLFDDL--IATIVDFDEDS 235
            |..|....::|        .|:.....:::.|:|::.|:..|.....|.:|:  |.|..:..|..
Human   242 KQENHGSLVSL--------GDEKQTKSRDLPPAEELPEKEHGKISCHLREDIAQIPTCAEAGEQE 298

  Fly   236 TPLVEFSMISDIMDEKLPVECGICPDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAG 300
            ..|......:......:..|||  ......|.||||.:.|  .|...|.|..|.:.:.....|..
Human   299 GRLQRKQKNATGGRRHICHECG--KSFAQSSGLSKHRRIH--TGEKPYECEECGKAFIGSSALVI 359

  Fly   301 HARRHMGIRPYVCELCTLYFSTKQDLRVHNQRRHL-EKEHICEVCGKTFAQNTQLKRHREATHEK 364
            |.|.|.|.:||.||.|...||...|| :.:||.|. ||.:.|:.|||||:|:..|..|.. .|..
Human   360 HQRVHTGEKPYECEECGKAFSHSSDL-IKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHR-IHTG 422

  Fly   365 KRRFQCEYCQKAYYKNFSLQEHIRNVHMG-------------KRRM------------LKCPFCG 404
            ::.:||..|.||:.::..|..|.| :|.|             |.||            .||..|.
Human   423 EKPYQCSMCGKAFRRSSHLLRHQR-IHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECE 486

  Fly   405 MQCRDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAHKRS 448
            ........:..|:| :|..:..|.|:.|.:.||.|||...|:||
Human   487 RSFTQNTGLIEHQK-IHTGEKPYQCNACGKGFTRISYLVQHQRS 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 7/18 (39%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 22/49 (45%)
C2H2 Zn finger 313..334 CDD:275368 9/20 (45%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
C2H2 Zn finger 370..388 CDD:275368 6/17 (35%)
C2H2 Zn finger 400..418 CDD:275370 3/17 (18%)
C2H2 Zn finger 429..447 CDD:275368 8/17 (47%)
ZKSCAN3NP_001229823.1 SCAN 42..154 CDD:128708
SCAN 42..130 CDD:280241
KRAB 214..274 CDD:214630 7/39 (18%)
KRAB 217..252 CDD:279668 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..274 7/39 (18%)
zf-C2H2 314..336 CDD:278523 8/23 (35%)
C2H2 Zn finger 316..336 CDD:275368 8/21 (38%)
zf-H2C2_2 329..351 CDD:290200 9/23 (39%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 356..381 CDD:290200 11/24 (46%)
COG5048 <368..515 CDD:227381 46/150 (31%)
C2H2 Zn finger 372..392 CDD:275368 9/20 (45%)
zf-H2C2_2 384..409 CDD:290200 13/25 (52%)
C2H2 Zn finger 400..420 CDD:275368 9/20 (45%)
zf-H2C2_2 412..437 CDD:290200 8/25 (32%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
zf-C2H2 480..502 CDD:278523 5/22 (23%)
C2H2 Zn finger 482..502 CDD:275368 4/20 (20%)
zf-H2C2_2 495..519 CDD:290200 7/24 (29%)
C2H2 Zn finger 510..530 CDD:275368 10/20 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.