DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2116 and ZFP2

DIOPT Version :9

Sequence 1:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster
Sequence 2:NP_085116.2 Gene:ZFP2 / 80108 HGNCID:26138 Length:461 Species:Homo sapiens


Alignment Length:237 Identity:70/237 - (29%)
Similarity:108/237 - (45%) Gaps:22/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PVECGICPDVMHKS-KLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCELC 316
            |.:|..|.....:| .|:.|.:||  .|...|.|..|.:.:....:|..|.|.|.|.:||.|..|
Human   213 PYKCNECGKAFTQSMNLTVHQRTH--TGEKPYECNECGKAFSQSMHLIVHQRSHTGEKPYECSQC 275

  Fly   317 TLYFSTKQDLRVHNQRRHL-EKEHICEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKN 380
            ...||....|.:| ||.|. ||.:.|..|||:|:|:|.|..| :..|...:.|:|..|.||:.||
Human   276 GKAFSKSSTLTLH-QRNHTGEKPYKCNKCGKSFSQSTYLIEH-QRLHSGVKPFECNECGKAFSKN 338

  Fly   381 FSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAH 445
            .||.:| |.:|.|: :..:|..||........:..| :.:|..:..|.|:.|.:.|:..:|...|
Human   339 SSLTQH-RRIHTGE-KPYECMVCGKHFTGRSSLTVH-QVIHTGEKPYECNECGKAFSQSAYLIEH 400

  Fly   446 KR------SIQCRSNTRRFVNADGNREGSDSESISGRNMNGQ 481
            :|      ..:|....:.|:.       :.|.::..|...|:
Human   401 QRIHTGEKPYECDQCGKAFIK-------NSSLTVHQRTHTGE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/19 (26%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
PHA00733 <308..357 CDD:177301 21/49 (43%)
C2H2 Zn finger 313..334 CDD:275368 8/20 (40%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
C2H2 Zn finger 370..388 CDD:275368 9/17 (53%)
C2H2 Zn finger 400..418 CDD:275370 4/17 (24%)
C2H2 Zn finger 429..447 CDD:275368 5/17 (29%)
ZFP2NP_085116.2 COG5048 99..451 CDD:227381 70/237 (30%)
C2H2 Zn finger 104..124 CDD:275368
C2H2 Zn finger 132..152 CDD:275368
C2H2 Zn finger 160..180 CDD:275368
C2H2 Zn finger 188..208 CDD:275368
C2H2 Zn finger 216..236 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 8/20 (40%)
C2H2 Zn finger 300..320 CDD:275368 9/20 (45%)
C2H2 Zn finger 328..348 CDD:275368 10/20 (50%)
C2H2 Zn finger 356..376 CDD:275368 4/20 (20%)
C2H2 Zn finger 384..404 CDD:275368 6/19 (32%)
C2H2 Zn finger 412..432 CDD:275368 4/26 (15%)
C2H2 Zn finger 440..460 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.